Comparing WP_015798162.1 NCBI__GCF_000023265.1:WP_015798162.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
53% identity, 73% coverage: 4:843/1151 of query aligns to 5:832/841 of 8g3hA
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
33% identity, 99% coverage: 8:1149/1151 of query aligns to 12:1190/1227 of P13009
Sites not aligning to the query:
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
31% identity, 99% coverage: 7:1149/1151 of query aligns to 25:1228/1265 of Q99707
8sseA Methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8 (see paper)
49% identity, 45% coverage: 635:1149/1151 of query aligns to 4:504/507 of 8sseA
4cczA Crystal structure of human 5-methyltetrahydrofolate-homocysteine methyltransferase, the homocysteine and folate binding domains
33% identity, 52% coverage: 7:601/1151 of query aligns to 9:598/611 of 4cczA
1q8jA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex) (see paper)
32% identity, 50% coverage: 2:577/1151 of query aligns to 5:539/559 of 1q8jA
3bofA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ and homocysteine (see paper)
32% identity, 50% coverage: 2:577/1151 of query aligns to 5:539/560 of 3bofA
5vooA Methionine synthase folate-binding domain with methyltetrahydrofolate from thermus thermophilus hb8 (see paper)
45% identity, 24% coverage: 335:615/1151 of query aligns to 1:279/282 of 5vooA
3bulA E. Coli i690c/g743c meth c-terminal fragment (649-1227) (see paper)
31% identity, 45% coverage: 627:1149/1151 of query aligns to 3:540/577 of 3bulA
3ivaA Structure of the b12-dependent methionine synthase (meth) c-teminal half with adohcy bound (see paper)
31% identity, 45% coverage: 627:1149/1151 of query aligns to 3:540/576 of 3ivaA
3k13C Structure of the pterin-binding domain metr of 5- methyltetrahydrofolate-homocysteine methyltransferase from bacteroides thetaiotaomicron
37% identity, 24% coverage: 333:613/1151 of query aligns to 1:280/287 of 3k13C
1bmtA How a protein binds b12: a 3.O angstrom x-ray structure of the b12- binding domains of methionine synthase (see paper)
37% identity, 19% coverage: 627:843/1151 of query aligns to 3:220/246 of 1bmtA
1mskA Methionine synthase (activation domain) (see paper)
29% identity, 23% coverage: 881:1149/1151 of query aligns to 10:290/327 of 1mskA
6bdyA Crystal structure of the meth reactivation domain bound to sinefungin (see paper)
29% identity, 23% coverage: 881:1149/1151 of query aligns to 10:290/326 of 6bdyA
2ycjA Methyltransferase bound with methyltetrahydrofolate (see paper)
31% identity, 21% coverage: 339:575/1151 of query aligns to 13:237/271 of 2ycjA
2yciX Methyltransferase native (see paper)
31% identity, 21% coverage: 339:575/1151 of query aligns to 13:237/271 of 2yciX
2yckX Methyltransferase bound with tetrahydrofolate (see paper)
31% identity, 21% coverage: 339:575/1151 of query aligns to 14:238/272 of 2yckX
4djfA Crystal structure of folate-bound corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr), co-crystallized with folate and ti(iii) citrate reductant (see paper)
31% identity, 21% coverage: 339:574/1151 of query aligns to 4:227/262 of 4djfA
4djeA Crystal structure of folate-bound corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr), co-crystallized with folate (see paper)
31% identity, 21% coverage: 339:574/1151 of query aligns to 4:227/262 of 4djeA
4djdA Crystal structure of folate-free corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr) (see paper)
31% identity, 21% coverage: 339:574/1151 of query aligns to 4:227/262 of 4djdA
>WP_015798162.1 NCBI__GCF_000023265.1:WP_015798162.1
MRTYEELLRERVVVFDGAMGTNLQLAGLGADDFGGPALEGCNEILVVTRPEAVAAVHDSF
LAVGVDVVETDTFGALAPVLAEYGIAERAYELNLRAAQLARDVASGYATPDHPRFVAGSM
GPGTKLPSLGQIPFEDLRDAYEVQAEGLIAGGVDLLLVETVYDLLSAKAAVIGARRAMRR
LGRSVPVQVQVTIETTGRMLPGTEVGAALAALERLDPVAIGINCATGPEEMGEHLRYLSE
HQRVPISCLPNAGMPHVVDGHMHYDLTPDALAAAHRRFVDELGVGIVGGCCGTRPEHLRA
VVEAVGEAVPRERHPTPRAQVASLYQAVELRQDLAITAVGERTNANGSRRFRDAMLARDW
DTCVRMAQDQVRDGAHMIDLCVDYTGEDGTVAMEELSSRLATASTLPIMIDSTEAAVVET
ALRHLGGRPIINSVNLEEGEGSNTRFDSFLRLAKDYGAAVVATCIDEEGQARTAARKVEI
AKRIVALAVERYGLATDDIIIDPLVLPVTTGMEESRRDALETIEALRRITAEMPGVSTLV
GLSNVSFGINAAAREALNSVFLAECQAAGLSMAILHPSRIQPLARIPEDVRAICLDLIYD
RRGQGDPLARLIERFADVQAVAVTGEELEALSVPERLHRRIVDANRQGLEDDLAAALGEG
MSALGVINDVLLPAMAEVGDLFGSGQMQLPFVLASAETMKQAVAWLEPYLDRASVNDRGT
VVLATVQGDVHDIGKNLVDIILTNNGYRVVNLGIKVALSEMLAAAEEHHADAIGMSGLLV
KSTLVMRDNLVEMNERGMAHLPVILGGAALTRTFVERDLRQVYDGRVFYGKDAFEGLDVL
ERLGRIRRGELDDPEFGRSIRQSSTRTPRLLRRSTSERTERSPTVAMDNPIFRPPFLGTR
VVKGIALDDIAAYVNETALFRHQWGYRPEGDEDDAAFKQRLRAELRRQLDRALVDQSLVP
QVVYGYFVAASEGNDLVVFADEAREHELARFRFPRQEQEPYLCIADFFRPLAGPEIDYVA
FHVVTMGPRITEVAKRAFDENRYQEYLLLHGLGVELTEALAEYWHARIRAEWGFGDEDGP
TLAGLFRQQYRGSRYSWGYPACPDLEDNRTVVDLLDAGRIGVSVSDTFQLEPEQTTTAII
VHHPQAKYFVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory