Comparing WP_015798328.1 NCBI__GCF_000023265.1:WP_015798328.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1zjjB Crystal structure of hypothetical protein ph1952 from pyrococcus horikoshii ot3
38% identity, 88% coverage: 4:231/260 of query aligns to 5:238/263 of 1zjjB
4o8cB Structure of the h170y mutant of thermostable p-nitrophenylphosphatase from bacillus stearothermophilus (see paper)
39% identity, 79% coverage: 3:208/260 of query aligns to 7:211/255 of 4o8cB
O33194 D-glycerol 3-phosphate phosphatase; D,L-glycerol 3-phosphate phosphatase; G3P phosphatase from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 93% coverage: 4:245/260 of query aligns to 12:251/353 of O33194
4i9gA Crystal structure of glycerol phosphate phosphatase rv1692 from mycobacterium tuberculosis in complex with magnesium (see paper)
36% identity, 93% coverage: 4:245/260 of query aligns to 13:252/329 of 4i9gA
4i9fA Crystal structure of glycerol phosphate phosphatase rv1692 from mycobacterium tuberculosis in complex with calcium (see paper)
36% identity, 93% coverage: 4:245/260 of query aligns to 11:250/336 of 4i9fA
P0DKC3 Phosphoglycolate phosphatase 1A, chloroplastic; EC 3.1.3.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 86% coverage: 3:226/260 of query aligns to 82:329/362 of P0DKC3
1ydfA Crystal structure of a had-like phosphatase from streptococcus pneumoniae
32% identity, 88% coverage: 3:231/260 of query aligns to 6:234/255 of 1ydfA
3qgmA P-nitrophenyl phosphatase from archaeoglobus fulgidus
29% identity, 88% coverage: 3:231/260 of query aligns to 6:235/261 of 3qgmA
4jdpB Crystal structure of probable p-nitrophenyl phosphatase (pho2) (target efi-501307) from archaeoglobus fulgidus dsm 4304 with magnesium bound
29% identity, 88% coverage: 3:231/260 of query aligns to 10:239/265 of 4jdpB
2cftA Crystal structure of human pyridoxal 5'-phosphate phosphatase with its substrate
31% identity, 93% coverage: 4:244/260 of query aligns to 23:277/292 of 2cftA
Sites not aligning to the query:
P60487 Chronophin; Pyridoxal 5'-phosphate phosphatase; Pyridoxal phosphate phosphatase; PLP phosphatase; EC 3.1.3.16; EC 3.1.3.74 from Mus musculus (Mouse) (see 3 papers)
28% identity, 93% coverage: 4:244/260 of query aligns to 23:275/292 of P60487
Q96GD0 Chronophin; Pyridoxal phosphate phosphatase; PLP phosphatase; EC 3.1.3.16; EC 3.1.3.74 from Homo sapiens (Human) (see 2 papers)
30% identity, 93% coverage: 4:244/260 of query aligns to 23:279/296 of Q96GD0
2oycA Crystal structure of human pyridoxal phosphate phosphatase (see paper)
29% identity, 93% coverage: 4:244/260 of query aligns to 24:277/292 of 2oycA
4bx2A Crystal structure of murine chronophin (pyridoxal phosphate phosphatase) in complex with beryllium trifluoride (see paper)
28% identity, 93% coverage: 4:244/260 of query aligns to 24:276/292 of 4bx2A
5aesA Crystal structure of murine chronophin (pyridoxal phosphate phosphatase) in complex with a pnp-derived inhibitor (see paper)
28% identity, 93% coverage: 4:244/260 of query aligns to 24:276/291 of 5aesA
Q8CHP8 Glycerol-3-phosphate phosphatase; G3PP; Aspartate-based ubiquitous Mg(2+)-dependent phosphatase; AUM; Phosphoglycolate phosphatase; PGP; EC 3.1.3.21; EC 3.1.3.48 from Mus musculus (Mouse) (see paper)
30% identity, 88% coverage: 4:231/260 of query aligns to 32:288/321 of Q8CHP8
5gynA Crystal structure of human pyridoxal 5'-phosphate phosphatase (chronophin) mutant - c221s
31% identity, 93% coverage: 4:244/260 of query aligns to 23:279/295 of 5gynA
7poeA Phosphoglycolate phosphatase with inhibitor cp1
30% identity, 88% coverage: 4:231/260 of query aligns to 22:278/311 of 7poeA
7po7H Phosphoglycolate phosphatase from mus musculus
30% identity, 88% coverage: 4:231/260 of query aligns to 22:278/311 of 7po7H
2c4nA Nagd from e.Coli k-12 strain (see paper)
29% identity, 88% coverage: 4:231/260 of query aligns to 7:229/250 of 2c4nA
>WP_015798328.1 NCBI__GCF_000023265.1:WP_015798328.1
MRWLIDLDGVVWRSSTLIEGSDRAIRRIRDRGDDLRFVTNNSTLTVEAYVAKLRSLGIDA
DANEILTSALAARLALGSDQRVLAIGEEGLTSVVAEGNTLVRPTSLEDAEKVDAVVMGWH
RGFTWDLLAQACVAIRAGARFLATNRDPTYPLERLVVPGTGALVASLVASTSVEPTYCGK
PDWPMVELVRPHLGATSTIMVGDRLTTDGAFARALEIPFALAASGIAEHDDGTTPVAVRA
ADLLGVVTAIDADPTILHAH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory