Comparing WP_015798369.1 NCBI__GCF_000023265.1:WP_015798369.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O58478 Alanine/serine racemase; ASR; Ala/Ser racemase; EC 5.1.1.-; EC 5.1.1.1 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see paper)
35% identity, 98% coverage: 2:423/431 of query aligns to 34:460/474 of O58478
1szkA The structure of gamma-aminobutyrate aminotransferase mutant: e211s (see paper)
35% identity, 97% coverage: 2:421/431 of query aligns to 5:420/425 of 1szkA
1sffA Structure of gamma-aminobutyrate aminotransferase complex with aminooxyacetate (see paper)
35% identity, 97% coverage: 2:421/431 of query aligns to 5:420/425 of 1sffA
1sf2A Structure of e. Coli gamma-aminobutyrate aminotransferase (see paper)
35% identity, 97% coverage: 2:421/431 of query aligns to 5:420/425 of 1sf2A
P22256 4-aminobutyrate aminotransferase GabT; 5-aminovalerate transaminase; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT; EC 2.6.1.19; EC 2.6.1.48 from Escherichia coli (strain K12) (see 2 papers)
35% identity, 97% coverage: 2:421/431 of query aligns to 6:421/426 of P22256
5g4jA Phospholyase a1rdf1 from arthrobacter in complex with phosphoethanolamine (see paper)
34% identity, 98% coverage: 2:422/431 of query aligns to 1:419/423 of 5g4jA
5g4iA Plp-dependent phospholyase a1rdf1 from arthrobacter aurescens tc1 (see paper)
34% identity, 98% coverage: 2:422/431 of query aligns to 1:419/423 of 5g4iA
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
37% identity, 94% coverage: 14:417/431 of query aligns to 11:379/390 of A0QYS9
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 97% coverage: 3:421/431 of query aligns to 61:453/457 of Q9M8M7
Sites not aligning to the query:
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
35% identity, 97% coverage: 4:423/431 of query aligns to 13:445/448 of 6io1B
6torB Human o-phosphoethanolamine phospho-lyase (see paper)
32% identity, 92% coverage: 23:419/431 of query aligns to 1:392/404 of 6torB
5wyaA Structure of amino acid racemase, 2.65 a (see paper)
33% identity, 94% coverage: 18:421/431 of query aligns to 24:429/439 of 5wyaA
Sites not aligning to the query:
4ysnC Structure of aminoacid racemase in complex with plp (see paper)
33% identity, 94% coverage: 18:421/431 of query aligns to 33:438/448 of 4ysnC
Sites not aligning to the query:
3q8nC Crystal structure of 4-aminobutyrate transaminase from mycobacterium smegmatis (see paper)
34% identity, 93% coverage: 22:423/431 of query aligns to 37:437/439 of 3q8nC
Sites not aligning to the query:
5wyfA Structure of amino acid racemase, 2.12 a (see paper)
33% identity, 94% coverage: 18:421/431 of query aligns to 26:431/446 of 5wyfA
Sites not aligning to the query:
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
31% identity, 96% coverage: 11:422/431 of query aligns to 3:390/390 of 8ht4B
P9WPZ7 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
35% identity, 92% coverage: 14:411/431 of query aligns to 19:383/400 of P9WPZ7
Sites not aligning to the query:
7nncC Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal-5'-phosphate and 6-methoxyquinoline-3-carboxylic acid
35% identity, 92% coverage: 14:411/431 of query aligns to 13:377/391 of 7nncC
7nn4A Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal 5'-phosphate and 3-hydroxy-2-naphthoic acid.
35% identity, 92% coverage: 14:411/431 of query aligns to 13:377/391 of 7nn4A
4atqF Gaba-transaminase a1r958 in complex with external aldimine plp-gaba adduct (see paper)
35% identity, 92% coverage: 22:417/431 of query aligns to 40:437/444 of 4atqF
Sites not aligning to the query:
>WP_015798369.1 NCBI__GCF_000023265.1:WP_015798369.1
MDLIERHRRVLPSWLSLYYDEPIELDRGEGCWVWDAHGERYLDCFGGILTTSVGHNVPEI
VSAISDQAARVIHSSTLYLNRPMIELAERLAKASGIPDAKVFFTTSGTEANDAALLLATA
ALGSNQVFALRNSYHGRSFTEIAVTGNRTWSPTSYSPLSVSWLQGGSRLRGPLAGLSDAE
YVARGVADLEDALLTTTAGRVAALIAEPIQGVGGFCLPPDGYFGELWRVTQREGILWISD
EVQTGFGRTGEHFWGYEAHGITPDLITFAKGVGNGMSLAGVIGRAEVMDALGTNSISTFG
GSPITAAAGVATFDYIIDHDLMANARARGAELREGLDAIARSTPAIGEVRGKGLMQGVEL
VWPGTVEPAPELATRALEAARREGVLIGKGGLHGNVLRIAPPMTISAEQIEHALEAFRRS
FADQAFHVKEQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory