SitesBLAST
Comparing WP_015820722.1 NCBI__GCF_000023025.1:WP_015820722.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
Q5F8J4 NAD(+)-dependent homoserine dehydrogenase; NAD(+)-dependent HSD; NgHSD; EC 1.1.1.3 from Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) (see paper)
28% identity, 100% coverage: 1:332/332 of query aligns to 1:319/435 of Q5F8J4
- L45 (≠ T52) mutation to R: Shows a marked increase in the catalytic efficiency with NADP(+).
- LS 45:46 (≠ TA 52:53) mutation to RD: Does not impair the catalytic activity with NAD(+). Slightly increases the activity, but slightly decreases the affinity for NADP(+).; mutation to RR: Causes a shift in coenzyme preference from NAD(+) to NADP(+) by a factor of 974. Shows a slight decrease in the catalytic efficiency with NAD(+) and a 4.5-fold increase in catalytic efficiency with NADP(+).
5x9dA Crystal structure of homoserine dehydrogenase in complex with l- cysteine and NAD (see paper)
34% identity, 71% coverage: 4:240/332 of query aligns to 1:223/302 of 5x9dA
- active site: D196 (= D213), K200 (= K217)
- binding (2R)-3-[[(4S)-3-aminocarbonyl-1-[(2R,3R,4S,5R)-5-[[[[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxymethyl]-3,4-bis(oxidanyl)oxolan-2-yl]-4H-pyridin-4-yl]sulfanyl]-2-azanyl-propanoic acid: F6 (≠ A9), G7 (= G10), Y8 (≠ A11), G9 (= G12), N10 (= N13), V11 (≠ I14), T37 (≠ N44), R38 (≠ S45), V72 (≠ A87), S73 (≠ G88), S74 (≠ P89), P82 (= P97), T100 (≠ I115), N101 (≠ S116), K102 (= K117), G127 (≠ C142), S131 (= S146), N155 (≠ T171), G156 (= G172), T157 (= T173), Y183 (≠ M200), A184 (≠ T201), E185 (= E202), D191 (= D208), D196 (= D213), K200 (= K217)
Sites not aligning to the query:
- binding (2R)-3-[[(4S)-3-aminocarbonyl-1-[(2R,3R,4S,5R)-5-[[[[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxymethyl]-3,4-bis(oxidanyl)oxolan-2-yl]-4H-pyridin-4-yl]sulfanyl]-2-azanyl-propanoic acid: 281, 282, 286
7f4cA The crystal structure of the immature holo-enzyme of homoserine dehydrogenase complexed with NADP and 1,4-butandiol from the hyperthermophilic archaeon sulfurisphaera tokodaii. (see paper)
34% identity, 71% coverage: 4:240/332 of query aligns to 1:223/300 of 7f4cA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: F6 (≠ A9), G7 (= G10), Y8 (≠ A11), G9 (= G12), N10 (= N13), V11 (≠ I14), T37 (≠ N44), R38 (≠ S45), R39 (= R46), V72 (≠ A87), S73 (≠ G88), S74 (≠ P89), T100 (≠ I115), K102 (= K117), G127 (≠ C142), S131 (= S146), E185 (= E202)
Sites not aligning to the query:
4pg7A Crystal structure of s. Aureus homoserine dehydrogenase at ph7.5 (see paper)
28% identity, 99% coverage: 1:329/332 of query aligns to 2:306/402 of 4pg7A
Sites not aligning to the query:
6dzsA Mycobacterial homoserine dehydrogenase thra in complex with NADP
29% identity, 99% coverage: 2:331/332 of query aligns to 3:323/431 of 6dzsA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G10), L12 (≠ A11), G13 (= G12), N14 (= N13), V15 (≠ I14), V45 (≠ N44), R46 (≠ S45), R47 (= R46), R52 (≠ K59), I63 (≠ L70), L78 (vs. gap), M79 (≠ A87), P84 (= P97), A102 (≠ I115), K104 (= K117), G306 (≠ S314), T310 (= T318)
6a0tB Homoserine dehydrogenase k99a mutant from thermus thermophilus hb8 complexed with hse and NADP+ (see paper)
31% identity, 93% coverage: 1:308/332 of query aligns to 1:284/332 of 6a0tB
- active site: D191 (= D213), K195 (= K217)
- binding l-homoserine: N150 (≠ T171), G151 (= G172), T152 (= T173), Y178 (≠ M200), E180 (= E202), D186 (= D208), K195 (= K217)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G10), G11 (≠ A11), G12 (= G12), T13 (≠ N13), V14 (≠ I14), L42 (= L50), V43 (≠ D51), R44 (≠ T52), D45 (≠ A53), K48 (≠ S56), R50 (≠ K58), A73 (= A87), M74 (≠ I93), G75 (≠ T94), A97 (≠ I115), N98 (≠ S116), G177 (= G199), E180 (= E202)
Sites not aligning to the query:
6a0sA Homoserine dehydrogenase from thermus thermophilus hb8 complexed with hse and NADPH (see paper)
31% identity, 93% coverage: 1:308/332 of query aligns to 1:284/331 of 6a0sA
- active site: D191 (= D213), K195 (= K217)
- binding l-homoserine: K99 (= K117), N150 (≠ T171), G151 (= G172), T152 (= T173), Y178 (≠ M200), E180 (= E202), D186 (= D208), K195 (= K217)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (≠ A11), G12 (= G12), T13 (≠ N13), V14 (≠ I14), L42 (= L50), V43 (≠ D51), R44 (≠ T52), D45 (≠ A53), K48 (≠ S56), R50 (≠ K58), A73 (= A87), M74 (≠ I93), A97 (≠ I115), K99 (= K117), G177 (= G199), E180 (= E202)
Sites not aligning to the query:
2ejwA Homoserine dehydrogenase from thermus thermophilus hb8
31% identity, 93% coverage: 1:308/332 of query aligns to 1:284/331 of 2ejwA
O81852 Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic; AK-HD 2; AK-HSDH 2; Beta-aspartyl phosphate homoserine 2; EC 2.7.2.4; EC 1.1.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 93% coverage: 3:310/332 of query aligns to 557:868/916 of O81852
Sites not aligning to the query:
- 441 I→A: Loss of threonine sensitivity for the aspartokinase activity and decreased inhibition of homoserine dehydrogenase activity by threonine.
- 443 Q→A: Loss of threonine sensitivity for the aspartokinase activity and decreased inhibition of homoserine dehydrogenase activity by threonine.
- 522 I→A: No effect on the inhibition of aspartokinase activity by threonine, but decreased inhibition of homoserine dehydrogenase activity by threonine.
- 524 Q→A: No effect on the inhibition of aspartokinase activity by threonine, but decreased inhibition of homoserine dehydrogenase activity by threonine.
3ingA Crystal structure of homoserine dehydrogenase (np_394635.1) from thermoplasma acidophilum at 1.95 a resolution
28% identity, 73% coverage: 2:244/332 of query aligns to 1:240/319 of 3ingA
- active site: D209 (= D213), K213 (= K217)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G10), T10 (≠ A11), G11 (= G12), N12 (= N13), V13 (≠ I14), D38 (≠ N44), S39 (= S45), K57 (= K59), C85 (≠ A87), T86 (≠ G88), P87 (= P89), A112 (≠ I115), N113 (≠ S116), K114 (= K117), A139 (≠ C142), E198 (= E202), S199 (≠ P203)
Sites not aligning to the query:
4xb2A Hyperthermophilic archaeal homoserine dehydrogenase mutant in complex with NADPH (see paper)
28% identity, 67% coverage: 4:226/332 of query aligns to 3:224/319 of 4xb2A
- active site: D211 (= D213), K215 (= K217)
- binding l-homoserine: A171 (≠ G172), S172 (≠ T173), D206 (= D208), K215 (= K217)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F8 (≠ A9), F10 (≠ A11), G11 (= G12), T12 (≠ N13), V13 (≠ I14), R40 (≠ S45), V91 (≠ A87), S92 (≠ G88), S93 (≠ P89), S114 (≠ I115), N115 (≠ S116), K116 (= K117), S141 (≠ C142)
Sites not aligning to the query:
4xb1A Hyperthermophilic archaeal homoserine dehydrogenase in complex with NADPH (see paper)
28% identity, 67% coverage: 4:226/332 of query aligns to 3:224/319 of 4xb1A
- active site: D211 (= D213), K215 (= K217)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F8 (≠ A9), F10 (≠ A11), G11 (= G12), T12 (≠ N13), V13 (≠ I14), D39 (≠ N44), R40 (≠ S45), K57 (≠ A61), V91 (≠ A87), S92 (≠ G88), S93 (≠ P89), S114 (≠ I115), K116 (= K117), S141 (≠ C142)
Sites not aligning to the query:
3jsaA Homoserine dehydrogenase from thermoplasma volcanium complexed with NAD
24% identity, 87% coverage: 1:289/332 of query aligns to 1:279/321 of 3jsaA
- active site: D212 (= D213), K216 (= K217)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), L11 (≠ A11), G12 (= G12), N13 (= N13), V14 (≠ I14), D42 (≠ N44), S43 (= S45), A90 (= A87), T91 (≠ G88), P92 (= P89), A117 (≠ I115), N118 (≠ S116), A144 (≠ C142)
Sites not aligning to the query:
P31116 Homoserine dehydrogenase; HDH; EC 1.1.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
23% identity, 92% coverage: 2:308/332 of query aligns to 4:333/359 of P31116
- 11:18 (vs. 9:16, 50% identical) binding
- T93 (≠ G88) binding
- K117 (= K117) binding
- E208 (= E202) binding ; mutation to D: Increases KM for aspartate-semialdehyde 48-fold and reduces kcat by 50%.; mutation E->L,Q: Loss of activity.
- D219 (= D213) mutation to L: Reduces kcat 150-fold.
- K223 (= K217) mutation to V: Loss of activity.
1tveA Homoserine dehydrogenase in complex with 4-(4-hydroxy-3- isopropylphenylthio)-2-isopropylphenol (see paper)
23% identity, 92% coverage: 2:308/332 of query aligns to 3:332/358 of 1tveA
1q7gA Homoserine dehydrogenase in complex with suicide inhibitor complex NAD-5-hydroxy-4-oxonorvaline (see paper)
23% identity, 92% coverage: 2:308/332 of query aligns to 3:332/358 of 1q7gA
- active site: D218 (= D213), K222 (= K217)
- binding nicotinamide-adenine-dinucleotide-5-hydroxy-4-oxonorvaline: G13 (= G12), V14 (≠ N13), V15 (≠ I14), E39 (≠ N44), N91 (≠ A87), T92 (≠ G88), S93 (≠ P89), I97 (= I93), P114 (≠ I115), K116 (= K117), A143 (≠ C142), S173 (≠ T171), K222 (= K217)
Sites not aligning to the query:
1ebuD Homoserine dehydrogenase complex with NAD analogue and l-homoserine (see paper)
23% identity, 92% coverage: 2:308/332 of query aligns to 3:332/358 of 1ebuD
- active site: D218 (= D213), K222 (= K217)
- binding 3-aminomethyl-pyridinium-adenine-dinucleotide: G11 (= G10), A12 (= A11), G13 (= G12), V14 (≠ N13), V15 (≠ I14), E39 (≠ N44), A40 (≠ S45), N91 (≠ A87), S93 (≠ P89), K116 (= K117)
Sites not aligning to the query:
1ebfA Homoserine dehydrogenase from s. Cerevisiae complex with NAD+ (see paper)
23% identity, 92% coverage: 2:308/332 of query aligns to 3:332/358 of 1ebfA
- active site: D218 (= D213), K222 (= K217)
- binding nicotinamide-adenine-dinucleotide: I10 (≠ A9), A12 (= A11), G13 (= G12), V14 (≠ N13), V15 (≠ I14), E39 (≠ N44), A40 (≠ S45), T92 (≠ G88), S93 (≠ P89), P114 (≠ I115)
O94671 Probable homoserine dehydrogenase; HDH; EC 1.1.1.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
23% identity, 91% coverage: 3:303/332 of query aligns to 7:336/376 of O94671
- S201 (= S187) modified: Phosphoserine
Query Sequence
>WP_015820722.1 NCBI__GCF_000023025.1:WP_015820722.1
MKTIKIAIAGAGNIGRALLDAIYEQADAFEQKHGVRLRVTGVCNSRGGLLDTAGLSPKKI
AEQSAFTPDLAGRNFVQQVDADILVEAGPSDYITGEPGLSYADAAIARGLHVIFISKGAM
LLHGTQLLEKARKQGVAIKYRCATASGLPAIDLLERAFANATIEKIEGVLTGTTSFILDK
MQSQRCSLTEALTEAQALGMTEPDPTNDLNGKDTACKLLIIANTAFRTQLTLADMSVSGI
ESVSPEDIATACAEGKTPRLIGSVARTTSGINAAVQLQYLNNTDTLARLNARDKALRIFT
REFGETILAGGSSSRDATIAAAMEDLAQIVRL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory