SitesBLAST
Comparing WP_015888271.1 NCBI__GCF_000018545.1:WP_015888271.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3B Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
59% identity, 96% coverage: 6:151/152 of query aligns to 7:152/154 of 8gy3B
- binding fe2/s2 (inorganic) cluster: G38 (= G37), C39 (= C38), G40 (= G39), G42 (≠ A41), C44 (= C43), G45 (= G44), C47 (= C46), C59 (= C58), C97 (= C96), C100 (= C99), Q101 (= Q100), C132 (= C131), C134 (= C133)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q96 (= Q95), C134 (= C133)
1t3qA Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
42% identity, 97% coverage: 5:151/152 of query aligns to 9:161/162 of 1t3qA
- binding fe2/s2 (inorganic) cluster: I40 (≠ F36), C42 (= C38), E43 (≠ G39), G45 (≠ A41), C47 (= C43), G48 (= G44), C50 (= C46), R60 (= R56), C62 (= C58), C101 (= C96), G102 (= G97), C104 (= C99), C136 (= C131), C138 (= C133)
- binding pterin cytosine dinucleotide: Q100 (= Q95), C138 (= C133)
5y6qA Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
44% identity, 97% coverage: 4:150/152 of query aligns to 7:155/157 of 5y6qA
- binding fe2/s2 (inorganic) cluster: G40 (= G37), C41 (= C38), D42 (≠ G39), G44 (≠ A41), C46 (= C43), G47 (= G44), C49 (= C46), C61 (= C58), C101 (= C96), G102 (= G97), C104 (= C99), C136 (= C131), C138 (= C133)
- binding pterin cytosine dinucleotide: Q100 (= Q95), C138 (= C133)
4zohC Crystal structure of glyceraldehyde oxidoreductase (see paper)
41% identity, 97% coverage: 4:150/152 of query aligns to 14:160/161 of 4zohC
- binding fe2/s2 (inorganic) cluster: C47 (= C38), S50 (≠ A41), C52 (= C43), G53 (= G44), C55 (= C46), C67 (= C58), C106 (= C96), G107 (= G97), C109 (= C99), C141 (= C131), C143 (= C133)
- binding pterin cytosine dinucleotide: Q105 (= Q95), C143 (= C133)
1sb3C Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
43% identity, 95% coverage: 4:147/152 of query aligns to 7:151/161 of 1sb3C
- binding fe2/s2 (inorganic) cluster: Q39 (≠ F36), C41 (= C38), G44 (≠ A41), C46 (= C43), G47 (= G44), C49 (= C46), C61 (= C58), C100 (= C96), G101 (= G97), C103 (= C99), C135 (= C131), C137 (= C133)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q95), C137 (= C133)
Q0QLF3 Nicotinate dehydrogenase small FeS subunit; NDH; Nicotinic acid hydroxylase small FeS subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
41% identity, 96% coverage: 4:149/152 of query aligns to 8:154/157 of Q0QLF3
- C42 (= C38) binding [2Fe-2S] cluster
- C47 (= C43) binding [2Fe-2S] cluster
- C50 (= C46) binding [2Fe-2S] cluster
- C62 (= C58) binding [2Fe-2S] cluster
- C101 (= C96) binding [2Fe-2S] cluster
- C104 (= C99) binding [2Fe-2S] cluster
- C136 (= C131) binding [2Fe-2S] cluster
- C138 (= C133) binding [2Fe-2S] cluster
3hrdD Crystal structure of nicotinate dehydrogenase (see paper)
41% identity, 96% coverage: 4:149/152 of query aligns to 8:154/160 of 3hrdD
- binding flavin-adenine dinucleotide: E44 (≠ V40), G45 (≠ A41), E46 (≠ Q42)
- binding fe2/s2 (inorganic) cluster: E40 (≠ F36), C42 (= C38), S43 (≠ G39), G45 (≠ A41), C47 (= C43), G48 (= G44), C50 (= C46), C62 (= C58), Q100 (= Q95), C101 (= C96), G102 (= G97), C104 (= C99), C136 (= C131), C138 (= C133)
- binding pterin cytosine dinucleotide: Q100 (= Q95), C138 (= C133)
8uemC The cryoem structure of the high affinity carbon monoxide dehydrogenase from mycobacterium smegmatis (see paper)
40% identity, 96% coverage: 4:149/152 of query aligns to 5:151/153 of 8uemC
- binding fe2/s2 (inorganic) cluster: W37 (≠ F36), G38 (= G37), C39 (= C38), S42 (≠ A41), N43 (≠ Q42), C44 (= C43), G45 (= G44), C47 (= C46), K57 (≠ R56), C59 (= C58), C98 (= C96), G99 (= G97), C101 (= C99), C133 (= C131), C135 (= C133)
- binding pterin cytosine dinucleotide: Q97 (= Q95), C135 (= C133)
1ffuD Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
38% identity, 97% coverage: 4:151/152 of query aligns to 7:155/156 of 1ffuD
- binding fe2/s2 (inorganic) cluster: C41 (= C38), S44 (≠ A41), H45 (≠ Q42), C46 (= C43), G47 (= G44), C49 (= C46), C61 (= C58), C100 (= C96), G101 (= G97), C103 (= C99), C135 (= C131), C137 (= C133)
1ffvA Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
38% identity, 97% coverage: 4:151/152 of query aligns to 6:154/155 of 1ffvA
- binding fe2/s2 (inorganic) cluster: I38 (≠ F36), C40 (= C38), S43 (≠ A41), C45 (= C43), G46 (= G44), C48 (= C46), C60 (= C58), C99 (= C96), G100 (= G97), C102 (= C99), C134 (= C131), C136 (= C133)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q98 (= Q95), C136 (= C133)
1n5wA Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
41% identity, 98% coverage: 4:152/152 of query aligns to 6:156/161 of 1n5wA
- binding flavin-adenine dinucleotide: S43 (≠ A41), H44 (≠ Q42)
- binding fe2/s2 (inorganic) cluster: I38 (≠ F36), G39 (= G37), C40 (= C38), S43 (≠ A41), C45 (= C43), G46 (= G44), C48 (= C46), C60 (= C58), C100 (= C96), G101 (= G97), C103 (= C99), C135 (= C131), C137 (= C133)
P19921 Carbon monoxide dehydrogenase small chain; CO dehydrogenase subunit S; CO-DH S; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
41% identity, 98% coverage: 4:152/152 of query aligns to 8:158/166 of P19921
- C42 (= C38) binding [2Fe-2S] cluster
- C47 (= C43) binding [2Fe-2S] cluster
- C50 (= C46) binding [2Fe-2S] cluster
- C62 (= C58) binding [2Fe-2S] cluster
- C102 (= C96) binding [2Fe-2S] cluster
- C105 (= C99) binding [2Fe-2S] cluster
- C137 (= C131) binding [2Fe-2S] cluster
- C139 (= C133) binding [2Fe-2S] cluster
1n5wD Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
41% identity, 98% coverage: 4:152/152 of query aligns to 6:156/158 of 1n5wD
- binding flavin-adenine dinucleotide: S43 (≠ A41), H44 (≠ Q42)
- binding fe2/s2 (inorganic) cluster: C40 (= C38), S43 (≠ A41), C45 (= C43), G46 (= G44), C48 (= C46), C60 (= C58), C100 (= C96), G101 (= G97), C103 (= C99), C135 (= C131), C137 (= C133)
- binding pterin cytosine dinucleotide: Q99 (= Q95), C137 (= C133)
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
39% identity, 99% coverage: 3:152/152 of query aligns to 5:158/907 of 4usaA
- binding fe2/s2 (inorganic) cluster: V38 (≠ F36), C40 (= C38), E41 (≠ G39), G43 (≠ A41), C45 (= C43), G46 (= G44), C48 (= C46), R58 (= R56), C60 (= C58), C100 (= C96), G101 (= G97), C103 (= C99), C137 (= C131), C139 (= C133)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q95), C139 (= C133)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 531, 532, 535, 539
- binding hydrocinnamic acid: 255, 425, 494, 497, 535, 626
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
39% identity, 99% coverage: 3:152/152 of query aligns to 5:158/907 of 4us9A
- binding fe2/s2 (inorganic) cluster: V38 (≠ F36), C40 (= C38), E41 (≠ G39), G43 (≠ A41), C45 (= C43), G46 (= G44), C48 (= C46), R58 (= R56), C60 (= C58), C100 (= C96), G101 (= G97), C103 (= C99), C137 (= C131), C139 (= C133)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q95), C139 (= C133)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 3-phenylpropanal: 255, 257, 258, 752
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
39% identity, 99% coverage: 3:152/152 of query aligns to 5:158/907 of 4us8A
- binding fe2/s2 (inorganic) cluster: V38 (≠ F36), C40 (= C38), E41 (≠ G39), G43 (≠ A41), C45 (= C43), G46 (= G44), C48 (= C46), R58 (= R56), C60 (= C58), C100 (= C96), G101 (= G97), C103 (= C99), C137 (= C131), C139 (= C133)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q95), C139 (= C133)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539
- binding benzaldehyde: 255, 255, 394, 425, 425, 425, 425, 497, 497, 501, 531, 535, 535, 626, 626, 626, 694, 696, 697
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
39% identity, 99% coverage: 3:152/152 of query aligns to 5:158/907 of 4c7yA
- binding fe2/s2 (inorganic) cluster: C40 (= C38), E41 (≠ G39), G43 (≠ A41), C45 (= C43), G46 (= G44), C48 (= C46), R58 (= R56), C60 (= C58), C100 (= C96), G101 (= G97), C103 (= C99), C137 (= C131), C139 (= C133)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q95), C139 (= C133)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 535, 539
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
- binding hydrogen peroxide: 696, 697, 869
3fc4A Ethylene glycol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
39% identity, 99% coverage: 3:152/152 of query aligns to 5:158/907 of 3fc4A
- binding fe2/s2 (inorganic) cluster: V38 (≠ F36), C40 (= C38), E41 (≠ G39), G43 (≠ A41), C45 (= C43), G46 (= G44), C48 (= C46), R58 (= R56), C60 (= C58), C100 (= C96), G101 (= G97), C103 (= C99), C137 (= C131), C139 (= C133)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q95), C139 (= C133)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 1,2-ethanediol: 535, 622, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
3fahA Glycerol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
39% identity, 99% coverage: 3:152/152 of query aligns to 5:158/907 of 3fahA
- binding fe2/s2 (inorganic) cluster: V38 (≠ F36), C40 (= C38), E41 (≠ G39), G43 (≠ A41), C45 (= C43), G46 (= G44), C48 (= C46), R58 (= R56), C60 (= C58), C100 (= C96), G101 (= G97), C103 (= C99), C137 (= C131), C139 (= C133)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q95), C139 (= C133)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding glycerol: 416, 535, 622, 683, 696, 697, 869, 884, 889, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
1sijA Crystal structure of the aldehyde dehydrogenase (a.K.A. Aor or mop) of desulfovibrio gigas covalently bound to [aso3]- (see paper)
39% identity, 99% coverage: 3:152/152 of query aligns to 5:158/907 of 1sijA
- binding fe2/s2 (inorganic) cluster: V38 (≠ F36), C40 (= C38), E41 (≠ G39), G43 (≠ A41), C45 (= C43), G46 (= G44), C48 (= C46), R58 (= R56), C60 (= C58), Q99 (= Q95), C100 (= C96), G101 (= G97), C103 (= C99), C137 (= C131), C139 (= C133)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q95), C139 (= C133)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding arsenite: 535, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 698, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
Query Sequence
>WP_015888271.1 NCBI__GCF_000018545.1:WP_015888271.1
MAIVTINGVEHSVDAEADMPLLWVIRDLVGLTGTKFGCGVAQCGACTVYVDGSPVRSCQT
FIGDIEGAKVTTIEGLQGKVAEAVQAIWADLDVPQCGYCQSGQIMSATDLLVNNPKPSDE
DIDAAMSGNLCRCATYHRIRAGIHEAAKRLEG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory