SitesBLAST
Comparing WP_015927792.1 NCBI__GCF_000022085.1:WP_015927792.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ij6A Crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from hydrogenobacter thermophilus tk-6 in complex with l-phosphoserine (see paper)
32% identity, 82% coverage: 22:185/199 of query aligns to 18:186/207 of 4ij6A
Sites not aligning to the query:
6m1xC Crystal structure of phosphoserine phosphatase in complex with 3- phosphoglyceric acid from entamoeba histolytica (see paper)
28% identity, 91% coverage: 3:183/199 of query aligns to 2:180/196 of 6m1xC
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
31% identity, 78% coverage: 3:158/199 of query aligns to 2:159/207 of 1h2fA
- active site: R8 (= R9), H9 (= H10), N15 (≠ T19), R58 (= R59), E82 (= E83), H150 (= H149)
- binding phosphate ion: T2 (= T3), T3 (= T4), G142 (≠ E141), E143 (≠ A142)
- binding trivanadate: R8 (= R9), H9 (= H10), N15 (≠ T19), Q21 (≠ P25), R58 (= R59), E82 (= E83), H150 (= H149), G151 (≠ A150), V152 (≠ D151)
Sites not aligning to the query:
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
31% identity, 78% coverage: 3:158/199 of query aligns to 2:159/207 of 1h2eA
5zr2C Crystal structure of phosphoserine phosphatase mutant (h9a) from entamoeba histolytica in complex with phosphoserine (see paper)
27% identity, 85% coverage: 14:183/199 of query aligns to 10:180/198 of 5zr2C
Sites not aligning to the query:
1k6mA Crystal structure of human liver 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase (see paper)
27% identity, 98% coverage: 4:199/199 of query aligns to 214:404/432 of 1k6mA
Sites not aligning to the query:
- binding phosphothiophosphoric acid-adenylate ester: 13, 14, 15, 16, 17, 18, 92, 120, 131, 134, 135, 136, 184, 210
1tipA The bisphosphatase domain of the bifunctional rat liver 6- phosphofructo-2-kinase/fructose-2,6-bisphosphatase (see paper)
27% identity, 95% coverage: 4:193/199 of query aligns to 3:187/191 of 1tipA
- active site: R8 (= R9), H9 (= H10), N15 (≠ T19), R58 (= R59), E78 (= E83), H143 (= H149)
- binding 6-O-phosphono-beta-D-fructofuranose: I20 (≠ M24), Y89 (≠ F94), R103 (≠ W106), K107 (≠ R110), Y118 (≠ I121), R148 (≠ K154)
1c81A Michaelis complex of fructose-2,6-bisphosphatase
27% identity, 95% coverage: 4:193/199 of query aligns to 3:187/191 of 1c81A
- active site: R8 (= R9), H9 (= H10), N15 (≠ T19), R58 (= R59), E78 (= E83), H143 (= H149)
- binding 2,5-anhydro-1-deoxy-1-phosphono-6-O-phosphono-D-glucitol: R8 (= R9), H9 (= H10), N15 (≠ T19), I20 (≠ M24), R58 (= R59), E78 (= E83), H143 (= H149), Q144 (≠ A150), R148 (≠ K154)
1c80A Regulatory complex of fructose-2,6-bisphosphatase
27% identity, 95% coverage: 4:193/199 of query aligns to 3:187/191 of 1c80A
- active site: R8 (= R9), H9 (= H10), N15 (≠ T19), R58 (= R59), E78 (= E83), H143 (= H149)
- binding guanosine-5'-triphosphate: I20 (≠ M24), E78 (= E83), I79 (= I84), Y89 (≠ F94), F100 (≠ W103), R103 (≠ W106), Y112 (≠ P115), Y118 (≠ I121), Q144 (≠ A150), A145 (≠ D151), R148 (≠ K154)
1c7zA Regulatory complex of fructose-2,6-bisphosphatase
27% identity, 95% coverage: 4:193/199 of query aligns to 3:187/191 of 1c7zA
- active site: R8 (= R9), H9 (= H10), N15 (≠ T19), R58 (= R59), E78 (= E83), H143 (= H149)
- binding glyceraldehyde-3-phosphate: Y89 (≠ F94), R103 (≠ W106), K107 (≠ R110), Y118 (≠ I121), Q144 (≠ A150), A145 (≠ D151), R148 (≠ K154)
1fbtA The bisphosphatase domain of the bifunctional rat liver 6- phosphofructo-2-kinase/fructose-2,6-bisphosphatase (see paper)
27% identity, 95% coverage: 4:193/199 of query aligns to 2:186/190 of 1fbtA
- active site: R7 (= R9), H8 (= H10), N14 (≠ T19), R57 (= R59), E77 (= E83), H142 (= H149)
- binding phosphate ion: R7 (= R9), H8 (= H10), R57 (= R59), E77 (= E83), H142 (= H149), Q143 (≠ A150)
5htkA Human heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (pfkfb2) (see paper)
27% identity, 98% coverage: 4:199/199 of query aligns to 221:411/425 of 5htkA
- active site: R226 (= R9), H227 (= H10), N233 (≠ T19), R276 (= R59), E296 (= E83), H361 (= H149)
- binding adenosine-5'-triphosphate: A397 (≠ E185), Y398 (≠ W186)
- binding 6-O-phosphono-beta-D-fructofuranose: H227 (= H10), I238 (≠ M24), G239 (≠ P25), E296 (= E83), Y307 (≠ F94), R321 (≠ W106), K325 (≠ R110), Y336 (≠ I121), Q362 (≠ A150), R366 (≠ K154)
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 17, 18, 19, 20, 21, 22, 140, 144, 145, 146
- binding citrate anion: 48, 61, 72, 99, 100, 167
1bifA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase bifunctional enzyme complexed with atp-g-s and phosphate (see paper)
26% identity, 98% coverage: 4:199/199 of query aligns to 214:404/432 of 1bifA
- active site: R219 (= R9), H220 (= H10), N226 (≠ T19), R269 (= R59), E289 (= E83), H354 (= H149)
- binding phosphothiophosphoric acid-adenylate ester: Y391 (≠ W186)
- binding phosphate ion: R219 (= R9), H220 (= H10), R269 (= R59), E289 (= E83), Y300 (≠ F94), R314 (≠ W106), K318 (≠ R110), Y329 (≠ I121), H354 (= H149), R359 (≠ K154)
Sites not aligning to the query:
- binding phosphothiophosphoric acid-adenylate ester: 11, 12, 13, 14, 15, 16, 17, 131, 134, 136, 184, 210
P25114 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4; 6PF-2-K/Fru-2,6-P2ase 4; PFK/FBPase 4; 6PF-2-K/Fru-2,6-P2ase testis-type isozyme; EC 2.7.1.105; EC 3.1.3.46 from Rattus norvegicus (Rat) (see 2 papers)
26% identity, 98% coverage: 4:199/199 of query aligns to 251:441/469 of P25114
- H257 (= H10) active site, Tele-phosphohistidine intermediate
- G269 (vs. gap) binding
- E326 (= E83) active site, Proton donor/acceptor
- Y337 (≠ F94) binding
- R351 (≠ W106) binding
- K355 (≠ R110) binding
- Y366 (≠ I121) binding
- Q392 (≠ A150) binding
- R396 (≠ K154) binding
- Y428 (≠ W186) binding
Sites not aligning to the query:
- 46:54 binding
- 79 binding
- 131 binding
- 137 binding
- 168:173 binding
- 198 binding
2bifA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase h256a mutant with f6p in phosphatase active site (see paper)
26% identity, 93% coverage: 14:199/199 of query aligns to 221:404/432 of 2bifA
- active site: N226 (≠ T19), R269 (= R59), E289 (= E83), H354 (= H149)
- binding phosphoaminophosphonic acid-adenylate ester: Y391 (≠ W186)
- binding 6-O-phosphono-beta-D-fructofuranose: I231 (≠ M24), G232 (vs. gap), E289 (= E83), Y300 (≠ F94), R314 (≠ W106), K318 (≠ R110), Y329 (≠ I121), Q355 (≠ A150), R359 (≠ K154)
- binding phosphate ion: N226 (≠ T19), R269 (= R59), H354 (= H149)
Sites not aligning to the query:
- active site: 219, 220
- binding phosphoaminophosphonic acid-adenylate ester: 11, 12, 13, 14, 15, 16, 17, 131, 184
- binding 6-O-phosphono-beta-D-fructofuranose: 407
- binding magnesium ion: 15, 16, 92
- binding phosphate ion: 219
6ibxA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 5 (see paper)
25% identity, 95% coverage: 4:193/199 of query aligns to 230:414/429 of 6ibxA
Sites not aligning to the query:
- binding 3-[[8-(1-methylindol-6-yl)quinoxalin-6-yl]amino]-~{N}-[(3~{S})-1-methylpiperidin-3-yl]pyridine-4-carboxamide: 28, 32, 33, 135, 137, 142, 146, 149, 150, 197, 224
- binding pyrophosphate 2-: 27, 28, 29, 30, 31, 32, 151
6ibzA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 7 (see paper)
25% identity, 95% coverage: 4:193/199 of query aligns to 232:416/431 of 6ibzA
Sites not aligning to the query:
- binding 2-[[8-(1-methylindol-6-yl)quinoxalin-6-yl]amino]-~{N}-(pyrimidin-5-ylmethyl)benzenesulfonamide: 30, 34, 35, 137, 139, 144, 148, 152, 199, 202, 226, 228
- binding phosphate ion: 28, 29, 30, 31, 32, 33, 153
6hviA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 2 (see paper)
25% identity, 95% coverage: 4:193/199 of query aligns to 234:418/433 of 6hviA
- active site: R239 (= R9), H240 (= H10), N246 (≠ T19), S289 (≠ R59), E309 (= E83), H374 (= H149)
- binding 6-O-phosphono-beta-D-fructofuranose: G252 (≠ P25), E309 (= E83), Y320 (≠ F94), R334 (≠ W106), K338 (≠ R110), Y349 (≠ I121), Q375 (≠ A150), R379 (≠ K154)
- binding pyrophosphate 2-: Y411 (≠ W186)
Sites not aligning to the query:
- binding 8-[3-(dimethylamino)phenyl]-~{N}-(4-methylsulfonylpyridin-3-yl)quinoxalin-6-amine: 32, 33, 36, 37, 139, 141, 146, 150, 153, 201, 204, 228, 230
- binding pyrophosphate 2-: 31, 32, 33, 34, 35, 36, 155
6hvhA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 1 (see paper)
25% identity, 95% coverage: 4:193/199 of query aligns to 232:416/431 of 6hvhA
- active site: R237 (= R9), H238 (= H10), N244 (≠ T19), S287 (≠ R59), E307 (= E83), H372 (= H149)
- binding 6-O-phosphono-beta-D-fructofuranose: I249 (≠ M24), G250 (≠ P25), E307 (= E83), Y318 (≠ F94), R332 (≠ W106), K336 (≠ R110), Y347 (≠ I121), Q373 (≠ A150), R377 (≠ K154)
- binding pyrophosphate 2-: Y409 (≠ W186)
Sites not aligning to the query:
- binding 3-[[8-(1-methylindol-6-yl)quinoxalin-6-yl]amino]-~{N}-(oxan-4-yl)pyridine-4-carboxamide: 30, 34, 35, 137, 139, 144, 148, 151, 152, 199, 202, 226, 228
- binding pyrophosphate 2-: 29, 30, 31, 32, 33, 34, 153
6ic0A Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 4 (see paper)
25% identity, 95% coverage: 4:193/199 of query aligns to 230:414/428 of 6ic0A
Sites not aligning to the query:
- binding 3-[[8-(1-methylindol-6-yl)quinoxalin-6-yl]amino]-~{N}-pyrimidin-5-yl-pyridine-4-carboxamide: 28, 29, 32, 33, 135, 137, 146, 149, 197, 200, 224, 226
- binding pyrophosphate 2-: 26, 27, 28, 29, 30, 31, 32, 151
Query Sequence
>WP_015927792.1 NCBI__GCF_000022085.1:WP_015927792.1
MTTTFFLVRHAAHGHLDRTLCGRMPGIRLGEEGRAQARALAARLKSERLDAVYASPLERA
QETGEPIAAAAGVPMRVLPALNEIDFGAWSGCSFEELHADPRWTLWNTARHVTRPPGGET
ILEAQARAVGALEELRASHGEARIALVSHADLIKLVLAFALGLAPDALGRFEVSPASISA
VVLGEWGAKVESINERVSA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory