SitesBLAST
Comparing WP_015929170.1 NCBI__GCF_000022085.1:WP_015929170.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4iymC Crystal structure of putative methylmalonate-semialdehyde dehydrogenase from sinorhizobium meliloti 1021 complexed with NAD, target 011934
62% identity, 98% coverage: 1:488/499 of query aligns to 3:490/491 of 4iymC
- active site: N153 (= N151), K176 (= K174), F250 (≠ L248), C284 (= C282), E386 (= E384), Q466 (≠ M464)
- binding nicotinamide-adenine-dinucleotide: I149 (= I147), T150 (= T148), P151 (= P149), F152 (= F150), N153 (= N151), F154 (= F152), K176 (= K174), K209 (= K207), V212 (= V210), F226 (= F224), V227 (= V225), G228 (= G226), S229 (= S227), I232 (= I230), G251 (= G249), C284 (= C282), E386 (= E384), F388 (= F386)
4zz7A Crystal structure of methylmalonate-semialdehyde dehydrogenase (dddc) from oceanimonas doudoroffii (see paper)
61% identity, 98% coverage: 3:490/499 of query aligns to 2:489/489 of 4zz7A
- active site: N149 (= N151), K172 (= K174), L246 (= L248), C280 (= C282), E382 (= E384), A462 (≠ M464)
- binding nicotinamide-adenine-dinucleotide: T146 (= T148), P147 (= P149), F148 (= F150), N149 (= N151), K172 (= K174), E175 (= E177), K205 (= K207), V208 (= V210), F222 (= F224), V223 (= V225), G224 (= G226), S225 (= S227), I228 (= I230), L246 (= L248), G247 (= G249), C280 (= C282), E382 (= E384), F384 (= F386)
5tjrD X-ray crystal structure of a methylmalonate semialdehyde dehydrogenase from pseudomonas sp. Aac (see paper)
60% identity, 96% coverage: 5:484/499 of query aligns to 3:456/468 of 5tjrD
- active site: N144 (= N151), K167 (= K174), L241 (= L248), C270 (= C282), E356 (= E384), A436 (≠ M464)
- binding adenosine-5'-diphosphate: I140 (= I147), T141 (= T148), F143 (= F150), K167 (= K174), E170 (= E177), K200 (= K207), F217 (= F224), S220 (= S227), I223 (= I230)
1t90A Crystal structure of methylmalonate semialdehyde dehydrogenase from bacillus subtilis
44% identity, 96% coverage: 4:484/499 of query aligns to 4:480/484 of 1t90A
- active site: N151 (= N151), K174 (= K174), L248 (= L248), C282 (= C282), E380 (= E384), A460 (≠ M464)
- binding nicotinamide-adenine-dinucleotide: I147 (= I147), A148 (≠ T148), P149 (= P149), F150 (= F150), N151 (= N151), W159 (= W159), K174 (= K174), E177 (= E177), R178 (= R178), H207 (≠ K207), V225 (= V225), G226 (= G226), S227 (= S227), V230 (≠ I230), L248 (= L248), T249 (≠ G249), C282 (= C282), E380 (= E384), F382 (= F386)
P42412 Malonate-semialdehyde dehydrogenase; MSA dehydrogenase; Methylmalonate-semialdehyde dehydrogenase; MMSA dehydrogenase; MMSDH; MSDH; EC 1.2.1.27 from Bacillus subtilis (strain 168) (see 3 papers)
44% identity, 96% coverage: 4:484/499 of query aligns to 6:482/487 of P42412
- C36 (≠ G34) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-160; A-287; A-351 and A-413.
- R107 (= R105) mutation to L: At least 50-fold decrease of the second-order rate constant for the acylation step.
- A150 (≠ T148) binding NAD(+)
- F152 (= F150) binding NAD(+)
- C160 (≠ M158) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-36; A-287; A-351 and A-413.
- K176 (= K174) binding NAD(+)
- E179 (= E177) binding NAD(+)
- R180 (= R178) binding NAD(+)
- S229 (= S227) binding NAD(+)
- T251 (≠ G249) binding NAD(+)
- R283 (= R281) mutation to L: At least 50-fold decrease of the second-order rate constant for the acylation step.
- C287 (≠ V285) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-36; A-160; A-351 and A-413.
- C351 (≠ V350) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-36; A-160; A-287 and A-413.
- E382 (= E384) binding NAD(+)
- C413 (≠ A415) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-36; A-160; A-287 and A-351.
1bpwA Betaine aldehyde dehydrogenase from cod liver (see paper)
33% identity, 95% coverage: 7:479/499 of query aligns to 22:492/503 of 1bpwA
- active site: N166 (= N151), K189 (= K174), E263 (≠ L248), C297 (= C282), E400 (= E384), E477 (≠ H462)
- binding nicotinamide-adenine-dinucleotide: I162 (= I147), L163 (≠ T148), W165 (≠ F150), N166 (= N151), K189 (= K174), G221 (≠ D206), G225 (≠ V210), T240 (≠ V225), G241 (= G226), S242 (= S227), T245 (≠ I230), E263 (≠ L248), L264 (≠ G249), C297 (= C282), E400 (= E384), F402 (= F386), F466 (= F451)
P56533 4-trimethylaminobutyraldehyde dehydrogenase; TMABA-DH; TMABADH; Aldehyde dehydrogenase family 9 member A1; Betaine aldehyde dehydrogenase; BADH; EC 1.2.1.47; EC 1.2.1.3 from Gadus morhua subsp. callarias (Baltic cod) (Gadus callarias) (see paper)
33% identity, 95% coverage: 7:479/499 of query aligns to 22:492/503 of P56533
Q9HTJ1 NAD/NADP-dependent betaine aldehyde dehydrogenase; BADH; EC 1.2.1.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
33% identity, 95% coverage: 8:479/499 of query aligns to 10:479/490 of Q9HTJ1
- GAWN 150:153 (≠ TPFN 148:151) binding NADPH
- K162 (≠ M160) active site, Charge relay system
- KPSE 176:179 (= KPSE 174:177) binding NADPH
- G209 (vs. gap) binding NADPH
- GTST 230:233 (≠ STPI 227:230) binding NADPH
- E252 (≠ G249) active site, Proton acceptor
- C286 (= C282) binding covalent; modified: Cysteine sulfenic acid (-SOH)
- E387 (= E384) binding NADPH
- E464 (≠ H462) active site, Charge relay system
4cazA Crystal structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa in complex with nadh
33% identity, 95% coverage: 8:479/499 of query aligns to 9:478/489 of 4cazA
- active site: N152 (= N151), K175 (= K174), E251 (≠ G249), C285 (= C282), E386 (= E384), E463 (≠ H462)
- binding [[(2R,3S,4R,5R)-5-[(3R)-3-aminocarbonyl-3,4-dihydro-2H-pyridin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanidyl-phosphoryl] [(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl phosphate: I148 (= I147), G149 (≠ T148), W151 (≠ F150), N152 (= N151), K175 (= K174), E178 (= E177), G208 (vs. gap), G212 (≠ V210), F226 (= F224), T227 (≠ V225), G228 (= G226), G229 (≠ S227), T232 (≠ I230), V236 (≠ I234), E251 (≠ G249), L252 (vs. gap), C285 (= C282), E386 (= E384), F388 (= F386)
2woxA Betaine aldehyde dehydrogenase from pseudomonas aeruginosa with NAD(p) h-catalytic thiol adduct. (see paper)
33% identity, 95% coverage: 8:479/499 of query aligns to 9:478/489 of 2woxA
- active site: N152 (= N151), K175 (= K174), E251 (≠ G249), C285 (= C282), E386 (= E384), E463 (≠ H462)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I148 (= I147), G149 (≠ T148), W151 (≠ F150), N152 (= N151), K175 (= K174), S177 (= S176), E178 (= E177), G208 (vs. gap), G212 (≠ V210), F226 (= F224), T227 (≠ V225), G228 (= G226), G229 (≠ S227), T232 (≠ I230), V236 (≠ I234), E251 (≠ G249), L252 (vs. gap), C285 (= C282), E386 (= E384), F388 (= F386)
2wmeA Crystallographic structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
33% identity, 95% coverage: 8:479/499 of query aligns to 9:478/489 of 2wmeA
- active site: N152 (= N151), K175 (= K174), E251 (≠ G249), C285 (= C282), E386 (= E384), E463 (≠ H462)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G149 (≠ T148), W151 (≠ F150), K175 (= K174), S177 (= S176), E178 (= E177), G208 (vs. gap), G212 (≠ V210), F226 (= F224), G228 (= G226), G229 (≠ S227), T232 (≠ I230), V236 (≠ I234)
8vr1A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (ctp bound)
36% identity, 96% coverage: 1:479/499 of query aligns to 2:477/488 of 8vr1A
8vr0A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (gmp bound)
36% identity, 96% coverage: 1:479/499 of query aligns to 2:477/488 of 8vr0A
8vqzA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (cmp bound)
36% identity, 96% coverage: 1:479/499 of query aligns to 2:477/488 of 8vqzA
8vqwC Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (coa bound)
36% identity, 96% coverage: 1:479/499 of query aligns to 2:477/488 of 8vqwC
- binding coenzyme a: I147 (= I147), W150 (≠ F150), K174 (= K174), S176 (= S176), E177 (= E177), G207 (≠ D206), G211 (≠ V210), F225 (= F224), G227 (= G226), G228 (≠ S227), S231 (≠ I230), H331 (= H330), F387 (= F386)
8vj3A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (fad bound)
36% identity, 96% coverage: 1:479/499 of query aligns to 2:477/488 of 8vj3A
8uzoA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (adp bound)
36% identity, 96% coverage: 1:479/499 of query aligns to 2:477/488 of 8uzoA
8uznA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (amp bound)
36% identity, 96% coverage: 1:479/499 of query aligns to 2:477/488 of 8uznA
- binding adenosine monophosphate: I147 (= I147), G148 (≠ T148), K174 (= K174), S176 (= S176), E177 (= E177), G207 (≠ D206), G211 (≠ V210), F225 (= F224), G228 (≠ S227), S231 (≠ I230), K234 (≠ Y233)
8uzmA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (NADPH bound)
36% identity, 96% coverage: 1:479/499 of query aligns to 2:477/488 of 8uzmA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G148 (≠ T148), W150 (≠ F150), K174 (= K174), S176 (= S176), E177 (= E177), G207 (≠ D206), G211 (≠ V210), F225 (= F224), T226 (≠ V225), G227 (= G226), G228 (≠ S227), S231 (≠ I230), E250 (≠ G249), G252 (= G250), C284 (= C282), E385 (= E384), F387 (= F386)
8uzkA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (NADP+ bound)
36% identity, 96% coverage: 1:479/499 of query aligns to 2:477/488 of 8uzkA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I147 (= I147), G148 (≠ T148), W150 (≠ F150), N151 (= N151), K174 (= K174), S176 (= S176), E177 (= E177), G207 (≠ D206), G211 (≠ V210), F225 (= F224), G227 (= G226), G228 (≠ S227), S231 (≠ I230), E250 (≠ G249), F387 (= F386)
Query Sequence
>WP_015929170.1 NCBI__GCF_000022085.1:WP_015929170.1
MASQIDHFIGGRRLAGRSGRSAPVFNPATGEQTGAVALADGSEVDAAVTAAAAAFPAWAR
TPPLRRARILNKFLQIIEDRIDSLAAVITAEHGKVLSDAKGEIQRGMEVIEFAVGAPQLL
KGEVTENVGTRVDSHALRQPLGVVAGITPFNFPVMVPMWMFPVALACGNCFVLKPSERDP
SASLLLAEWLKEAGLPDGVFNVVHGDKEAVDALLHHPKVAGVSFVGSTPIARYIYATATA
NGKRAQALGGAKNHMIIMPDADMDQAVDALMGAAYGSAGERCMAVSVAVPVGEKTANTLV
ERLIPKVRALKVGPGTDRDSEMGPLVTRQHLDKVRGYIAQGVSEGAKLLVDGRDLKLQGY
ETGFFIGGTLFDHVTPEMTIYKEEIFGPVLAVTRAPDYATAARLINEHEFGNGTAIFTRD
GDAAREFAHEIQVGMVGINVPIPVPMAFHSFGGWKASLFGDHHMHGPEGVRFYTRLKAIT
TRWPTGIRAGADFVMPTME
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory