SitesBLAST – Find functional sites

 

SitesBLAST

Comparing WP_015929903.1 NCBI__GCF_000022085.1:WP_015929903.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found no hits to proteins with known functional sites (download)

Query Sequence

>WP_015929903.1 NCBI__GCF_000022085.1:WP_015929903.1
MSVDAQTVRRIAHLARIAVSDAEVPPLQDELNAILAFVEQLGAVDVSGVEPMTSVTPMAM
KQREDAVTDGGYARDIVFNAPLTEDNYFLVPKVVE

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory