SitesBLAST
Comparing WP_015931899.1 NCBI__GCF_000022085.1:WP_015931899.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1t9dA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
48% identity, 95% coverage: 7:571/592 of query aligns to 8:577/596 of 1t9dA
- active site: Y29 (= Y28), G31 (= G30), G32 (= G31), A33 (= A32), I34 (≠ V33), E55 (= E54), T78 (= T77), F117 (= F116), Q118 (= Q117), E119 (= E118), K167 (= K166), R227 (= R227), M263 (= M263), V290 (≠ I290), V406 (= V399), L431 (= L424), G432 (= G425), M434 (= M427), D459 (≠ E452), N486 (= N479), E488 (≠ Y481), Q489 (≠ M482), M491 (= M484), V492 (= V485), W495 (= W488), L517 (= L511), G522 (= G516), L523 (≠ A517), K556 (= K550)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G31), A33 (= A32), V107 (= V106), P108 (= P107), F117 (= F116), K167 (= K166), M263 (= M263), D288 (= D288), R289 (= R289), W495 (= W488)
- binding flavin-adenine dinucleotide: R157 (= R156), G216 (= G215), A217 (≠ G216), G218 (= G217), N221 (= N220), T243 (= T243), L244 (= L244), Q245 (≠ M245), M260 (= M260), L261 (= L261), H264 (= H264), G283 (= G283), A284 (= A284), R285 (= R285), D287 (= D287), R289 (= R289), V290 (≠ I290), E316 (≠ D307), V317 (≠ I308), N321 (≠ S312), G334 (= G325), D335 (= D326), A336 (≠ C327), Q410 (= Q403), M411 (= M404), G429 (= G422), G430 (= G423)
- binding magnesium ion: D459 (≠ E452), N486 (= N479), E488 (≠ Y481)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E55 (= E54), P81 (= P80), Q118 (= Q117), G432 (= G425), M434 (= M427), M464 (= M457)
1t9bB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
48% identity, 95% coverage: 7:571/592 of query aligns to 8:576/595 of 1t9bB
- active site: Y29 (= Y28), G31 (= G30), G32 (= G31), A33 (= A32), I34 (≠ V33), E55 (= E54), T78 (= T77), F117 (= F116), Q118 (= Q117), E119 (= E118), K167 (= K166), R226 (= R227), M262 (= M263), V289 (≠ I290), V405 (= V399), L430 (= L424), G431 (= G425), M433 (= M427), D458 (≠ E452), N485 (= N479), E487 (≠ Y481), Q488 (≠ M482), M490 (= M484), V491 (= V485), W494 (= W488), L516 (= L511), G521 (= G516), L522 (≠ A517), K555 (= K550)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V106), P108 (= P107), D287 (= D288), R288 (= R289), M490 (= M484), W494 (= W488)
- binding flavin-adenine dinucleotide: R157 (= R156), G215 (= G215), A216 (≠ G216), G217 (= G217), N220 (= N220), T242 (= T243), L243 (= L244), Q244 (≠ M245), M259 (= M260), L260 (= L261), M262 (= M263), H263 (= H264), G282 (= G283), A283 (= A284), R284 (= R285), D286 (= D287), R288 (= R289), V289 (≠ I290), E315 (≠ D307), V316 (≠ I308), N320 (≠ S312), G333 (= G325), D334 (= D326), A335 (≠ C327), Q409 (= Q403), M410 (= M404), G428 (= G422), G429 (= G423)
- binding magnesium ion: D458 (≠ E452), N485 (= N479), E487 (≠ Y481)
1t9aA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
48% identity, 95% coverage: 7:571/592 of query aligns to 9:578/597 of 1t9aA
- active site: Y30 (= Y28), G32 (= G30), G33 (= G31), A34 (= A32), I35 (≠ V33), E56 (= E54), T79 (= T77), F118 (= F116), Q119 (= Q117), E120 (= E118), K168 (= K166), R228 (= R227), M264 (= M263), V291 (≠ I290), V407 (= V399), L432 (= L424), G433 (= G425), M435 (= M427), D460 (≠ E452), N487 (= N479), E489 (≠ Y481), Q490 (≠ M482), M492 (= M484), V493 (= V485), W496 (= W488), L518 (= L511), G523 (= G516), L524 (≠ A517), K557 (= K550)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: G33 (= G31), V108 (= V106), P109 (= P107), F118 (= F116), K168 (= K166), M264 (= M263), D289 (= D288), R290 (= R289), M492 (= M484), V493 (= V485), W496 (= W488)
- binding flavin-adenine dinucleotide: R158 (= R156), G217 (= G215), A218 (≠ G216), G219 (= G217), N222 (= N220), T244 (= T243), L245 (= L244), Q246 (≠ M245), L262 (= L261), M264 (= M263), H265 (= H264), G284 (= G283), A285 (= A284), R286 (= R285), D288 (= D287), R290 (= R289), V291 (≠ I290), E317 (≠ D307), V318 (≠ I308), N322 (≠ S312), G335 (= G325), D336 (= D326), A337 (≠ C327), Q411 (= Q403), M412 (= M404), G430 (= G422), G431 (= G423)
- binding magnesium ion: D460 (≠ E452), N487 (= N479), E489 (≠ Y481)
- binding propyl trihydrogen diphosphate: V407 (= V399), G408 (= G400), Q409 (= Q401), H410 (= H402), M435 (= M427), G459 (= G451), D460 (≠ E452), A461 (= A453), S462 (= S454), N487 (= N479), E489 (≠ Y481), Q490 (≠ M482), G491 (= G483), M492 (= M484)
- binding 5-{[ethyl(methyl)amino]methyl}-2-methyl-5,6-dihydropyrimidin-4-amine: G433 (= G425), M435 (= M427), M465 (= M457)
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
48% identity, 95% coverage: 7:571/592 of query aligns to 8:577/596 of 1t9cA
- active site: Y29 (= Y28), G31 (= G30), G32 (= G31), A33 (= A32), I34 (≠ V33), E55 (= E54), T78 (= T77), F117 (= F116), Q118 (= Q117), E119 (= E118), K167 (= K166), R227 (= R227), M263 (= M263), V290 (≠ I290), V406 (= V399), L431 (= L424), G432 (= G425), M434 (= M427), D459 (≠ E452), N486 (= N479), E488 (≠ Y481), Q489 (≠ M482), M491 (= M484), V492 (= V485), W495 (= W488), L517 (= L511), G522 (= G516), L523 (≠ A517), K556 (= K550)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G31), V107 (= V106), P108 (= P107), F117 (= F116), K167 (= K166), D288 (= D288), R289 (= R289), W495 (= W488)
- binding flavin-adenine dinucleotide: R157 (= R156), G216 (= G215), A217 (≠ G216), G218 (= G217), N221 (= N220), T243 (= T243), L244 (= L244), Q245 (≠ M245), L261 (= L261), M263 (= M263), H264 (= H264), G283 (= G283), A284 (= A284), R285 (= R285), D287 (= D287), R289 (= R289), V290 (≠ I290), E316 (≠ D307), V317 (≠ I308), N321 (≠ S312), G334 (= G325), D335 (= D326), A336 (≠ C327), M411 (= M404), G429 (= G422), G430 (= G423)
- binding magnesium ion: D459 (≠ E452), N486 (= N479), E488 (≠ Y481)
1n0hA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl (see paper)
48% identity, 95% coverage: 7:571/592 of query aligns to 10:580/599 of 1n0hA
- active site: Y31 (= Y28), G33 (= G30), G34 (= G31), A35 (= A32), I36 (≠ V33), E57 (= E54), T80 (= T77), F119 (= F116), Q120 (= Q117), E121 (= E118), K169 (= K166), R230 (= R227), M266 (= M263), V293 (≠ I290), V409 (= V399), L434 (= L424), G435 (= G425), M437 (= M427), D462 (≠ E452), N489 (= N479), E491 (≠ Y481), Q492 (≠ M482), M494 (= M484), V495 (= V485), W498 (= W488), L520 (= L511), G525 (= G516), L526 (≠ A517), K559 (= K550)
- binding 4-{[(4'-amino-2'-methylpyrimidin-5'-yl)methyl]amino}pent-3-enyl diphosphate: V409 (= V399), G410 (= G400), Q411 (= Q401), H412 (= H402), G435 (= G425), M437 (= M427), G461 (= G451), D462 (≠ E452), A463 (= A453), S464 (= S454), M467 (= M457), N489 (= N479), E491 (≠ Y481), Q492 (≠ M482), G493 (= G483), V495 (= V485)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: G34 (= G31), A35 (= A32), V109 (= V106), P110 (= P107), F119 (= F116), K169 (= K166), M266 (= M263), D291 (= D288), R292 (= R289), V495 (= V485), W498 (= W488)
- binding flavin-adenine dinucleotide: R159 (= R156), G219 (= G215), A220 (≠ G216), G221 (= G217), N224 (= N220), T246 (= T243), L247 (= L244), Q248 (≠ M245), L264 (= L261), G265 (= G262), M266 (= M263), H267 (= H264), G286 (= G283), A287 (= A284), R288 (= R285), D290 (= D287), R292 (= R289), V293 (≠ I290), E319 (≠ D307), V320 (≠ I308), N324 (≠ S312), G337 (= G325), D338 (= D326), A339 (≠ C327), M414 (= M404), G432 (= G422), G433 (= G423)
- binding magnesium ion: D462 (≠ E452), N489 (= N479), E491 (≠ Y481)
- binding thiamine diphosphate: Y31 (= Y28), E57 (= E54), P83 (= P80)
5wkcA Saccharomyces cerevisiae acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
48% identity, 95% coverage: 7:571/592 of query aligns to 8:572/591 of 5wkcA
- active site: Y29 (= Y28), G31 (= G30), G32 (= G31), A33 (= A32), I34 (≠ V33), E55 (= E54), T78 (= T77), F117 (= F116), Q118 (= Q117), E119 (= E118), K167 (= K166), R222 (= R227), M258 (= M263), V285 (≠ I290), V401 (= V399), L426 (= L424), G427 (= G425), M429 (= M427), D454 (≠ E452), N481 (= N479), E483 (≠ Y481), Q484 (≠ M482), M486 (= M484), V487 (= V485), W490 (= W488), L512 (= L511), G517 (= G516), L518 (≠ A517), K551 (= K550)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V401 (= V399), G402 (= G400), Q403 (= Q401), H404 (= H402), G427 (= G425), M429 (= M427), G453 (= G451), D454 (≠ E452), A455 (= A453), S456 (= S454), M459 (= M457), N481 (= N479), E483 (≠ Y481), Q484 (≠ M482), G485 (= G483), M486 (= M484), V487 (= V485)
- binding ethaneperoxoic acid: G32 (= G31), Q118 (= Q117)
- binding flavin-adenine dinucleotide: R157 (= R156), G211 (= G215), A212 (≠ G216), G213 (= G217), N216 (= N220), T238 (= T243), L239 (= L244), Q240 (≠ M245), L256 (= L261), M258 (= M263), G278 (= G283), A279 (= A284), R280 (= R285), R284 (= R289), V285 (≠ I290), E311 (≠ D307), V312 (≠ I308), N316 (≠ S312), D330 (= D326), A331 (≠ C327), M406 (= M404), G424 (= G422)
- binding magnesium ion: D454 (≠ E452), N481 (= N479), E483 (≠ Y481)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: G32 (= G31), A33 (= A32), V107 (= V106), F117 (= F116), K167 (= K166), M258 (= M263), R284 (= R289), M486 (= M484), W490 (= W488)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: P30 (= P29), E55 (= E54)
6u9dB Saccharomyces cerevisiae acetohydroxyacid synthase (see paper)
47% identity, 95% coverage: 7:571/592 of query aligns to 12:588/607 of 6u9dB
- active site: Y33 (= Y28), G35 (= G30), G36 (= G31), A37 (= A32), I38 (≠ V33), E59 (= E54), T82 (= T77), F121 (= F116), Q122 (= Q117), E123 (= E118), K171 (= K166), M274 (= M263), V301 (≠ I290), V417 (= V399), G443 (= G425), M445 (= M427), D470 (≠ E452), N497 (= N479), E499 (≠ Y481), Q500 (≠ M482), M502 (= M484), V503 (= V485), W506 (= W488)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: G36 (= G31), V111 (= V106), P112 (= P107), F121 (= F116), K171 (= K166), D299 (= D288), R300 (= R289), M502 (= M484), W506 (= W488)
- binding flavin-adenine dinucleotide: R161 (= R156), A228 (≠ G216), G229 (= G217), N232 (= N220), T254 (= T243), L255 (= L244), Q256 (≠ M245), L272 (= L261), M274 (= M263), G294 (= G283), R296 (= R285), D298 (= D287), R300 (= R289), V301 (≠ I290), E327 (≠ D307), V328 (≠ I308), N332 (≠ S312), D346 (= D326), A347 (≠ C327), M422 (= M404), G440 (= G422), G441 (= G423)
- binding magnesium ion: D470 (≠ E452), N497 (= N479)
- binding thiamine diphosphate: E59 (= E54), P85 (= P80), V417 (= V399), G418 (= G400), Q419 (= Q401), H420 (= H402), G443 (= G425), M445 (= M427), A471 (= A453), S472 (= S454), N497 (= N479), E499 (≠ Y481), Q500 (≠ M482), G501 (= G483), M502 (= M484), V503 (= V485)
P07342 Acetolactate synthase catalytic subunit, mitochondrial; Acetohydroxy-acid synthase catalytic subunit; AHAS; ALS; EC 2.2.1.6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
47% identity, 95% coverage: 7:571/592 of query aligns to 92:668/687 of P07342
- R241 (= R156) binding
- 355:376 (vs. 264:285, 55% identical) binding
- 407:426 (vs. 307:326, 35% identical) binding
1t9bA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
48% identity, 95% coverage: 7:571/592 of query aligns to 8:564/583 of 1t9bA
- active site: Y29 (= Y28), G31 (= G30), G32 (= G31), A33 (= A32), I34 (≠ V33), E55 (= E54), T78 (= T77), F117 (= F116), Q118 (= Q117), E119 (= E118), K167 (= K166), R214 (= R227), M250 (= M263), V277 (≠ I290), V393 (= V399), L418 (= L424), G419 (= G425), M421 (= M427), D446 (≠ E452), N473 (= N479), E475 (≠ Y481), Q476 (≠ M482), M478 (= M484), V479 (= V485), W482 (= W488), L504 (= L511), G509 (= G516), L510 (≠ A517), K543 (= K550)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V106), P108 (= P107), F117 (= F116), D275 (= D288), R276 (= R289), M478 (= M484), W482 (= W488)
- binding flavin-adenine dinucleotide: R157 (= R156), G203 (= G215), A204 (≠ G216), G205 (= G217), N208 (= N220), T230 (= T243), L231 (= L244), Q232 (≠ M245), M247 (= M260), L248 (= L261), M250 (= M263), H251 (= H264), G270 (= G283), A271 (= A284), R272 (= R285), D274 (= D287), R276 (= R289), V277 (≠ I290), E303 (≠ D307), V304 (≠ I308), N308 (≠ S312), D322 (= D326), A323 (≠ C327), Q397 (= Q403), M398 (= M404), G416 (= G422), G417 (= G423)
- binding magnesium ion: D446 (≠ E452), N473 (= N479), E475 (≠ Y481)
6demA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide bensulfuron methyl (see paper)
47% identity, 95% coverage: 7:571/592 of query aligns to 12:578/597 of 6demA
- active site: Y33 (= Y28), G35 (= G30), G36 (= G31), A37 (= A32), I38 (≠ V33), E59 (= E54), T82 (= T77), F121 (= F116), Q122 (= Q117), E123 (= E118), K171 (= K166), K228 (≠ R227), M264 (= M263), V291 (≠ I290), V407 (= V399), L432 (= L424), G433 (= G425), M435 (= M427), D460 (≠ E452), N487 (= N479), E489 (≠ Y481), Q490 (≠ M482), M492 (= M484), V493 (= V485), W496 (= W488), L518 (= L511), N523 (≠ G516), V524 (≠ A517)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: M264 (= M263), D289 (= D288), R290 (= R289), M492 (= M484), W496 (= W488), A567 (≠ S560)
- binding flavin-adenine dinucleotide: R161 (= R156), G217 (= G215), A218 (≠ G216), G219 (= G217), N222 (= N220), T244 (= T243), L245 (= L244), Q246 (≠ M245), L262 (= L261), G284 (= G283), A285 (= A284), R286 (= R285), D288 (= D287), R290 (= R289), V291 (≠ I290), E317 (≠ D307), I318 (= I308), N322 (≠ S312), D336 (= D326), V337 (≠ C327), M412 (= M404), G430 (= G422)
- binding magnesium ion: D460 (≠ E452), N487 (= N479), E489 (≠ Y481)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (= V399), G408 (= G400), Q409 (= Q401), H410 (= H402), M435 (= M427), G459 (= G451), D460 (≠ E452), A461 (= A453), S462 (= S454), M465 (= M457), N487 (= N479), E489 (≠ Y481), Q490 (≠ M482), G491 (= G483), M492 (= M484), V493 (= V485)
6delA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide chlorimuron ethyl (see paper)
47% identity, 95% coverage: 7:571/592 of query aligns to 12:578/597 of 6delA
- active site: Y33 (= Y28), G35 (= G30), G36 (= G31), A37 (= A32), I38 (≠ V33), E59 (= E54), T82 (= T77), F121 (= F116), Q122 (= Q117), E123 (= E118), K171 (= K166), K228 (≠ R227), M264 (= M263), V291 (≠ I290), V407 (= V399), L432 (= L424), G433 (= G425), M435 (= M427), D460 (≠ E452), N487 (= N479), E489 (≠ Y481), Q490 (≠ M482), M492 (= M484), V493 (= V485), W496 (= W488), L518 (= L511), N523 (≠ G516), V524 (≠ A517)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: D289 (= D288), R290 (= R289), W496 (= W488)
- binding flavin-adenine dinucleotide: R161 (= R156), G217 (= G215), A218 (≠ G216), G219 (= G217), N222 (= N220), T244 (= T243), L245 (= L244), Q246 (≠ M245), L262 (= L261), G284 (= G283), A285 (= A284), R286 (= R285), D288 (= D287), R290 (= R289), V291 (≠ I290), E317 (≠ D307), I318 (= I308), N322 (≠ S312), D336 (= D326), V337 (≠ C327), M412 (= M404), G430 (= G422)
- binding (3Z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl](formyl)amino}-3-sulfanylpent-3-en-1-yl trihydrogen diphosphate: V407 (= V399), G408 (= G400), Q409 (= Q401), H410 (= H402), G433 (= G425), M435 (= M427), G459 (= G451), D460 (≠ E452), A461 (= A453), S462 (= S454), M465 (= M457), N487 (= N479), E489 (≠ Y481), Q490 (≠ M482), G491 (= G483), M492 (= M484), V493 (= V485)
- binding magnesium ion: D460 (≠ E452), N487 (= N479), E489 (≠ Y481)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (= V399), G408 (= G400), Q409 (= Q401), H410 (= H402), G433 (= G425), M435 (= M427), G459 (= G451), D460 (≠ E452), A461 (= A453), S462 (= S454), M465 (= M457), N487 (= N479), E489 (≠ Y481), Q490 (≠ M482), G491 (= G483), M492 (= M484), V493 (= V485)
1t9dB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
48% identity, 95% coverage: 7:571/592 of query aligns to 7:563/582 of 1t9dB
- active site: Y28 (= Y28), G30 (= G30), G31 (= G31), A32 (= A32), I33 (≠ V33), E54 (= E54), T77 (= T77), F116 (= F116), Q117 (= Q117), E118 (= E118), K166 (= K166), R213 (= R227), M249 (= M263), V276 (≠ I290), V392 (= V399), L417 (= L424), G418 (= G425), M420 (= M427), D445 (≠ E452), N472 (= N479), E474 (≠ Y481), Q475 (≠ M482), M477 (= M484), V478 (= V485), W481 (= W488), L503 (= L511), G508 (= G516), L509 (≠ A517), K542 (= K550)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G31 (= G31), A32 (= A32), V106 (= V106), P107 (= P107), F116 (= F116), K166 (= K166), M249 (= M263), D274 (= D288), R275 (= R289), W481 (= W488)
- binding flavin-adenine dinucleotide: R156 (= R156), G202 (= G215), A203 (≠ G216), G204 (= G217), N207 (= N220), T229 (= T243), L230 (= L244), Q231 (≠ M245), L247 (= L261), M249 (= M263), H250 (= H264), G269 (= G283), A270 (= A284), R271 (= R285), D273 (= D287), R275 (= R289), V276 (≠ I290), E302 (≠ D307), V303 (≠ I308), N307 (≠ S312), G320 (= G325), D321 (= D326), A322 (≠ C327), Q396 (= Q403), M397 (= M404), G415 (= G422), G416 (= G423)
- binding magnesium ion: D445 (≠ E452), N472 (= N479), E474 (≠ Y481)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E54 (= E54), P80 (= P80), G418 (= G425), M420 (= M427), M450 (= M457)
6desA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide propoxycarbazone (see paper)
47% identity, 95% coverage: 7:571/592 of query aligns to 12:579/598 of 6desA
- active site: Y33 (= Y28), G35 (= G30), G36 (= G31), A37 (= A32), I38 (≠ V33), E59 (= E54), T82 (= T77), F121 (= F116), Q122 (= Q117), E123 (= E118), K171 (= K166), K229 (≠ R227), M265 (= M263), V292 (≠ I290), V408 (= V399), L433 (= L424), G434 (= G425), M436 (= M427), D461 (≠ E452), N488 (= N479), E490 (≠ Y481), Q491 (≠ M482), M493 (= M484), V494 (= V485), W497 (= W488), L519 (= L511), N524 (≠ G516), V525 (≠ A517)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: M265 (= M263), D290 (= D288), R291 (= R289), W497 (= W488)
- binding flavin-adenine dinucleotide: R161 (= R156), G218 (= G215), A219 (≠ G216), G220 (= G217), N223 (= N220), T245 (= T243), L246 (= L244), Q247 (≠ M245), L263 (= L261), G285 (= G283), A286 (= A284), R287 (= R285), D289 (= D287), R291 (= R289), V292 (≠ I290), E318 (≠ D307), I319 (= I308), N323 (≠ S312), D337 (= D326), V338 (≠ C327), Q412 (= Q403), M413 (= M404), G431 (= G422)
- binding magnesium ion: D461 (≠ E452), N488 (= N479), E490 (≠ Y481)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (= V399), G409 (= G400), Q410 (= Q401), H411 (= H402), G434 (= G425), M436 (= M427), G460 (= G451), D461 (≠ E452), A462 (= A453), S463 (= S454), N488 (= N479), E490 (≠ Y481), Q491 (≠ M482), G492 (= G483), M493 (= M484), V494 (= V485)
6depA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide sulfometuron methyl (see paper)
47% identity, 95% coverage: 7:571/592 of query aligns to 12:579/598 of 6depA
- active site: Y33 (= Y28), G35 (= G30), G36 (= G31), A37 (= A32), I38 (≠ V33), E59 (= E54), T82 (= T77), F121 (= F116), Q122 (= Q117), E123 (= E118), K171 (= K166), K229 (≠ R227), M265 (= M263), V292 (≠ I290), V408 (= V399), L433 (= L424), G434 (= G425), M436 (= M427), D461 (≠ E452), N488 (= N479), E490 (≠ Y481), Q491 (≠ M482), M493 (= M484), V494 (= V485), W497 (= W488), L519 (= L511), N524 (≠ G516), V525 (≠ A517)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D290 (= D288), R291 (= R289), M493 (= M484), W497 (= W488)
- binding flavin-adenine dinucleotide: R161 (= R156), G218 (= G215), A219 (≠ G216), G220 (= G217), N223 (= N220), T245 (= T243), L246 (= L244), Q247 (≠ M245), L263 (= L261), G264 (= G262), G285 (= G283), A286 (= A284), R287 (= R285), D289 (= D287), R291 (= R289), V292 (≠ I290), E318 (≠ D307), I319 (= I308), N323 (≠ S312), D337 (= D326), V338 (≠ C327), M413 (= M404), G431 (= G422)
- binding magnesium ion: D461 (≠ E452), N488 (= N479), E490 (≠ Y481)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V408 (= V399), G409 (= G400), Q410 (= Q401), H411 (= H402), G434 (= G425), M436 (= M427), G460 (= G451), D461 (≠ E452), A462 (= A453), S463 (= S454), M466 (= M457), N488 (= N479), E490 (≠ Y481), Q491 (≠ M482), G492 (= G483), M493 (= M484), V494 (= V485)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (= V399), G409 (= G400), Q410 (= Q401), H411 (= H402), G434 (= G425), M436 (= M427), G460 (= G451), D461 (≠ E452), A462 (= A453), S463 (= S454), M466 (= M457), N488 (= N479), E490 (≠ Y481), Q491 (≠ M482), G492 (= G483), M493 (= M484), V494 (= V485)
6derA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide metosulam (see paper)
47% identity, 95% coverage: 7:571/592 of query aligns to 14:581/600 of 6derA
- active site: Y35 (= Y28), G37 (= G30), G38 (= G31), A39 (= A32), I40 (≠ V33), E61 (= E54), T84 (= T77), F123 (= F116), Q124 (= Q117), E125 (= E118), K173 (= K166), K231 (≠ R227), M267 (= M263), V294 (≠ I290), V410 (= V399), L435 (= L424), G436 (= G425), M438 (= M427), D463 (≠ E452), N490 (= N479), E492 (≠ Y481), Q493 (≠ M482), M495 (= M484), V496 (= V485), W499 (= W488), L521 (= L511), N526 (≠ G516), V527 (≠ A517)
- binding flavin-adenine dinucleotide: R163 (= R156), G220 (= G215), A221 (≠ G216), G222 (= G217), N225 (= N220), T247 (= T243), L248 (= L244), Q249 (≠ M245), L265 (= L261), H268 (= H264), G287 (= G283), A288 (= A284), R289 (= R285), D291 (= D287), R293 (= R289), V294 (≠ I290), E320 (≠ D307), I321 (= I308), N325 (≠ S312), G338 (= G325), D339 (= D326), V340 (≠ C327), Q414 (= Q403), M415 (= M404), G433 (= G422)
- binding Metosulam: R293 (= R289), M495 (= M484), W499 (= W488), A570 (≠ S560)
- binding magnesium ion: D463 (≠ E452), N490 (= N479), E492 (≠ Y481)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V410 (= V399), G411 (= G400), Q412 (= Q401), H413 (= H402), G436 (= G425), M438 (= M427), G462 (= G451), D463 (≠ E452), A464 (= A453), S465 (= S454), N490 (= N479), E492 (≠ Y481), Q493 (≠ M482), G494 (= G483), M495 (= M484), V496 (= V485)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V410 (= V399), G411 (= G400), Q412 (= Q401), H413 (= H402), G436 (= G425), M438 (= M427), G462 (= G451), D463 (≠ E452), A464 (= A453), S465 (= S454), M468 (= M457), N490 (= N479), E492 (≠ Y481), Q493 (≠ M482), G494 (= G483), V496 (= V485)
6denA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron ethyl (see paper)
47% identity, 95% coverage: 7:571/592 of query aligns to 14:580/599 of 6denA
- active site: Y35 (= Y28), G37 (= G30), G38 (= G31), A39 (= A32), I40 (≠ V33), E61 (= E54), T84 (= T77), F123 (= F116), Q124 (= Q117), E125 (= E118), K173 (= K166), K230 (≠ R227), M266 (= M263), V293 (≠ I290), V409 (= V399), L434 (= L424), G435 (= G425), M437 (= M427), D462 (≠ E452), N489 (= N479), E491 (≠ Y481), Q492 (≠ M482), M494 (= M484), V495 (= V485), W498 (= W488), L520 (= L511), N525 (≠ G516), V526 (≠ A517)
- binding flavin-adenine dinucleotide: R163 (= R156), G219 (= G215), A220 (≠ G216), G221 (= G217), N224 (= N220), T246 (= T243), L247 (= L244), Q248 (≠ M245), L264 (= L261), G286 (= G283), A287 (= A284), R288 (= R285), D290 (= D287), R292 (= R289), V293 (≠ I290), E319 (≠ D307), I320 (= I308), N324 (≠ S312), D338 (= D326), V339 (≠ C327), M414 (= M404), G432 (= G422)
- binding ethyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M266 (= M263), D291 (= D288), R292 (= R289), W498 (= W488)
- binding magnesium ion: D462 (≠ E452), N489 (= N479), E491 (≠ Y481)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V409 (= V399), G410 (= G400), Q411 (= Q401), H412 (= H402), G435 (= G425), M437 (= M427), G461 (= G451), D462 (≠ E452), A463 (= A453), S464 (= S454), N489 (= N479), E491 (≠ Y481), Q492 (≠ M482), G493 (= G483), M494 (= M484), V495 (= V485)
6deoA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron methyl (see paper)
47% identity, 95% coverage: 7:571/592 of query aligns to 10:574/593 of 6deoA
- active site: Y31 (= Y28), G33 (= G30), G34 (= G31), A35 (= A32), I36 (≠ V33), E57 (= E54), T80 (= T77), F119 (= F116), Q120 (= Q117), E121 (= E118), K169 (= K166), K224 (≠ R227), M260 (= M263), V287 (≠ I290), V403 (= V399), L428 (= L424), G429 (= G425), M431 (= M427), D456 (≠ E452), N483 (= N479), E485 (≠ Y481), Q486 (≠ M482), M488 (= M484), V489 (= V485), W492 (= W488), L514 (= L511), N519 (≠ G516), V520 (≠ A517)
- binding flavin-adenine dinucleotide: R159 (= R156), G213 (= G215), A214 (≠ G216), G215 (= G217), N218 (= N220), T240 (= T243), L241 (= L244), Q242 (≠ M245), L258 (= L261), G280 (= G283), A281 (= A284), R282 (= R285), D284 (= D287), R286 (= R289), V287 (≠ I290), E313 (≠ D307), I314 (= I308), N318 (≠ S312), D332 (= D326), V333 (≠ C327), M408 (= M404), G426 (= G422)
- binding methyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M260 (= M263), D285 (= D288), R286 (= R289), M488 (= M484), W492 (= W488)
- binding magnesium ion: D456 (≠ E452), N483 (= N479), E485 (≠ Y481)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V403 (= V399), G404 (= G400), Q405 (= Q401), H406 (= H402), G429 (= G425), M431 (= M427), G455 (= G451), D456 (≠ E452), A457 (= A453), S458 (= S454), M461 (= M457), N483 (= N479), E485 (≠ Y481), Q486 (≠ M482), G487 (= G483), M488 (= M484), V489 (= V485)
6deqA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
47% identity, 95% coverage: 7:571/592 of query aligns to 14:582/601 of 6deqA
- active site: Y35 (= Y28), G37 (= G30), G38 (= G31), A39 (= A32), I40 (≠ V33), E61 (= E54), T84 (= T77), F123 (= F116), Q124 (= Q117), E125 (= E118), K173 (= K166), K232 (≠ R227), M268 (= M263), V295 (≠ I290), V411 (= V399), L436 (= L424), G437 (= G425), M439 (= M427), D464 (≠ E452), N491 (= N479), E493 (≠ Y481), Q494 (≠ M482), M496 (= M484), V497 (= V485), W500 (= W488), L522 (= L511), N527 (≠ G516), V528 (≠ A517)
- binding flavin-adenine dinucleotide: R163 (= R156), G221 (= G215), A222 (≠ G216), G223 (= G217), N226 (= N220), T248 (= T243), L249 (= L244), Q250 (≠ M245), L266 (= L261), G288 (= G283), A289 (= A284), R290 (= R285), D292 (= D287), R294 (= R289), V295 (≠ I290), E321 (≠ D307), I322 (= I308), D340 (= D326), V341 (≠ C327), M416 (= M404), G434 (= G422)
- binding magnesium ion: D464 (≠ E452), N491 (= N479), E493 (≠ Y481)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M268 (= M263), R294 (= R289), M496 (= M484), V497 (= V485), W500 (= W488), A571 (≠ S560)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V411 (= V399), G412 (= G400), Q413 (= Q401), H414 (= H402), M439 (= M427), G463 (= G451), D464 (≠ E452), A465 (= A453), S466 (= S454), N491 (= N479), E493 (≠ Y481), Q494 (≠ M482), G495 (= G483), M496 (= M484), V497 (= V485)
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
47% identity, 95% coverage: 9:568/592 of query aligns to 99:661/670 of P17597
- A122 (= A32) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ L34) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E54) binding
- S186 (= S96) binding
- P197 (= P107) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ H109) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q117) binding
- K220 (= K130) binding
- R246 (= R156) binding ; binding
- K256 (= K166) binding
- G308 (= G216) binding
- TL 331:332 (= TL 243:244) binding
- C340 (≠ G252) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (= LGMH 261:264) binding
- GVRFD 371:375 (≠ GARFD 283:287) binding
- DR 376:377 (= DR 288:289) binding
- DI 395:396 (= DI 307:308) binding
- DV 414:415 (≠ DC 326:327) binding
- QH 487:488 (= QH 401:402) binding
- GG 508:509 (= GG 422:423) binding
- GAM 511:513 (≠ GTM 425:427) binding
- D538 (≠ E452) binding
- DGS 538:540 (≠ EAS 452:454) binding
- N565 (= N479) binding
- NQHLGM 565:570 (≠ NEYMGM 479:484) binding
- H567 (≠ Y481) binding
- W574 (= W488) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- S653 (= S560) binding ; mutation to A: No effect on catalytic activity or sensitivity to herbicides.; mutation to F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; mutation to N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; mutation to T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
47% identity, 95% coverage: 9:568/592 of query aligns to 14:576/585 of 5k2oA
- active site: Y33 (= Y28), G35 (= G30), G36 (= G31), A37 (= A32), S38 (≠ V33), E59 (= E54), T82 (= T77), F121 (= F116), Q122 (= Q117), E123 (= E118), K171 (= K166), M266 (= M263), V293 (≠ I290), V400 (= V399), G426 (= G425), M428 (= M427), D453 (≠ E452), N480 (= N479), H482 (≠ Y481), L483 (≠ M482), M485 (= M484), V486 (= V485), W489 (= W488), H558 (≠ K550)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (= M263), R292 (= R289), W489 (= W488), S568 (= S560)
- binding flavin-adenine dinucleotide: R161 (= R156), G222 (= G215), G223 (= G216), G224 (= G217), T246 (= T243), L247 (= L244), M248 (= M245), L264 (= L261), G286 (= G283), R288 (= R285), D290 (= D287), V293 (≠ I290), D310 (= D307), I311 (= I308), D329 (= D326), V330 (≠ C327), Q404 (= Q403), M405 (= M404), G423 (= G422)
- binding magnesium ion: D453 (≠ E452), N480 (= N479), H482 (≠ Y481)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V399), G401 (= G400), Q402 (= Q401), H403 (= H402), M428 (= M427), D453 (≠ E452), G454 (≠ A453), S455 (= S454), N480 (= N479), H482 (≠ Y481), L483 (≠ M482), G484 (= G483), M485 (= M484), V486 (= V485)
Query Sequence
>WP_015931899.1 NCBI__GCF_000022085.1:WP_015931899.1
MGAGEVMTGAEMVIRALQDQGVDTLFGYPGGAVLPIYDALFHQDSVKHVLVRHEQGAVHA
AEGYARSSGKVGCVLVTSGPGATNVITGLTDALLDSIPLVCITGQVPTHLIGSDAFQECD
TVGITRSCTKHNYLVKSIEDLPRILHEAFYVASHGRPGPVVVDLPKDIQFASGLYRRPVE
NGHKTYRPTIHGDLAKIRAAVALMAGARRPVFYTGGGVINSGPEASRLLRELVRATGFPI
TSTLMGLGAYPGSDPQFLGMLGMHGTYEANLAMHECDLMICIGARFDDRITGRLDAFSPF
SKKIHVDIDASSINKNVKADIGILGDCASVLADMLKEWRAVTPEPDKGRLTEWLSKINGW
KARECLGYWPSGTTIKPQYAVQRLYEATKNRETYVTTEVGQHQMWAAQYYKFEEPNRWMT
SGGLGTMGYGLPAAIGTQLAHPGALVIDIAGEASILMNMQEMSTAVQYRLPVKIFILNNE
YMGMVRQWQELLHGSRYSESYSASLPDFVKLAEAYGAKGIRCEKPGDLDAAIQEMLDYDG
PVIFDCIVDKTENCFPMIPSGKAHNEMLLSDYLGETGADLGSVISEEGKVLV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory