SitesBLAST
Comparing WP_015932020.1 NCBI__GCF_000022085.1:WP_015932020.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O94582 Probable anthranilate synthase component 1; Anthranilate synthase component I; EC 4.1.3.27 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
38% identity, 99% coverage: 1:499/504 of query aligns to 1:483/489 of O94582
- S390 (= S407) modified: Phosphoserine
- S392 (≠ A409) modified: Phosphoserine
Sites not aligning to the query:
- 488 modified: Phosphoserine
A0QX93 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
44% identity, 91% coverage: 26:485/504 of query aligns to 48:510/524 of A0QX93
- K355 (≠ E330) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
5cwaA Structure of anthranilate synthase component i (trpe) from mycobacterium tuberculosis with inhibitor bound (see paper)
43% identity, 91% coverage: 26:485/504 of query aligns to 28:489/505 of 5cwaA
- active site: Q248 (= Q250), E301 (= E297), A317 (= A313), E345 (= E341), H382 (= H378), T409 (= T405), Y433 (= Y429), R453 (= R449), G469 (= G465), E482 (= E478), K486 (= K482)
- binding 3-{[(1Z)-1-carboxyprop-1-en-1-yl]oxy}-2-hydroxybenzoic acid: Y433 (= Y429), I452 (≠ L448), A466 (= A462), G467 (= G463), K486 (= K482)
7bvdA Anthranilate synthase component i (trpe)[mycolicibacterium smegmatis]
43% identity, 91% coverage: 26:485/504 of query aligns to 28:485/499 of 7bvdA
- active site: Q248 (= Q250), E301 (= E297), A317 (= A313), E341 (= E341), H378 (= H378), T405 (= T405), Y429 (= Y429), R449 (= R449), G465 (= G465), E478 (= E478), K482 (= K482)
- binding pyruvic acid: S93 (≠ D95), G94 (≠ D96), A100 (≠ S102)
7pi1DDD Aminodeoxychorismate synthase component 1
38% identity, 91% coverage: 34:491/504 of query aligns to 17:454/459 of 7pi1DDD
- binding magnesium ion: G428 (= G465), E438 (= E475)
- binding tryptophan: L33 (= L51), E34 (= E52), S35 (= S53), G39 (= G57), Y41 (= Y63), P242 (= P279), Y243 (≠ F280), M244 (≠ L281), Q406 (≠ D443), N408 (≠ C445)
P28820 Aminodeoxychorismate synthase component 1; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 1; EC 2.6.1.85 from Bacillus subtilis (strain 168) (see paper)
39% identity, 91% coverage: 34:491/504 of query aligns to 19:461/470 of P28820
- A283 (= A313) mutation to I: Complete loss of aminodeoxychorismate synthase activity.; mutation to K: Absence of covalent intermediate.; mutation to V: Complete loss of aminodeoxychorismate synthase activity.
Q94GF1 Anthranilate synthase alpha subunit 1, chloroplastic; OsASA1; EC 4.1.3.27 from Oryza sativa subsp. japonica (Rice) (see paper)
39% identity, 96% coverage: 11:493/504 of query aligns to 54:570/577 of Q94GF1
- D323 (≠ L263) mutation to N: Insensitive to feedback inhibition by tryptophan.
P32068 Anthranilate synthase alpha subunit 1, chloroplastic; Anthranilate synthase component 1-1; Anthranilate synthase component I-1; Protein A-METHYL TRYPTOPHAN RESISTANT 1; Protein JASMONATE-INDUCED DEFECTIVE LATERAL ROOT 1; Protein TRYPTOPHAN BIOSYNTHESIS 5; Protein WEAK ETHYLENE INSENSITIVE 2; EC 4.1.3.27 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 93% coverage: 26:493/504 of query aligns to 86:588/595 of P32068
- D341 (≠ L263) mutation to N: In trp5-1; insensitive to feedback inhibition by tryptophan and resistance to the herbicide 6-methylanthranilate.
1i7sA Anthranilate synthase from serratia marcescens in complex with its end product inhibitor l-tryptophan (see paper)
38% identity, 77% coverage: 100:489/504 of query aligns to 115:500/511 of 1i7sA
- active site: Q254 (= Q250), E300 (= E297), A318 (= A313), E352 (= E341), H389 (= H378), T416 (= T405), Y440 (= Y429), R460 (= R449), G476 (= G465), E489 (= E478), K493 (= K482)
- binding tryptophan: P282 (= P279), Y283 (≠ F280), M284 (≠ L281), V444 (≠ I433), G445 (= G434), D454 (= D443), C456 (= C445)
Sites not aligning to the query:
1i7qA Anthranilate synthase from s. Marcescens (see paper)
38% identity, 77% coverage: 100:489/504 of query aligns to 121:506/517 of 1i7qA
- active site: Q260 (= Q250), E306 (= E297), A324 (= A313), E358 (= E341), H395 (= H378), T422 (= T405), Y446 (= Y429), R466 (= R449), G482 (= G465), E495 (= E478), K499 (= K482)
- binding magnesium ion: E358 (= E341), E495 (= E478)
- binding pyruvic acid: Y446 (= Y429), I465 (≠ L448), R466 (= R449), A479 (= A462), G480 (= G463), K499 (= K482)
P00897 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Serratia marcescens (see paper)
38% identity, 77% coverage: 100:489/504 of query aligns to 123:508/519 of P00897
Sites not aligning to the query:
1i1qA Structure of the cooperative allosteric anthranilate synthase from salmonella typhimurium (see paper)
39% identity, 73% coverage: 127:493/504 of query aligns to 144:509/512 of 1i1qA
- active site: Q259 (= Q250), E305 (= E297), A323 (= A313), E357 (= E341), H394 (= H378), T421 (= T405), Y445 (= Y429), R465 (= R449), G481 (= G465), E494 (= E478), K498 (= K482)
- binding tryptophan: P287 (= P279), Y288 (≠ F280), M289 (≠ L281), G450 (= G434), C461 (= C445)
Sites not aligning to the query:
P00898 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
39% identity, 73% coverage: 127:493/504 of query aligns to 148:513/520 of P00898
- C174 (≠ I154) mutation to Y: Almost no change in feedback control by tryptophan.
- N288 (= N276) mutation to D: Decrease in feedback control by tryptophan.
- P289 (= P277) mutation to L: Decrease in feedback control by tryptophan.
- M293 (≠ L281) mutation to T: Complete loss of feedback control by tryptophan.
- F294 (≠ C282) mutation to L: Decrease in feedback control by tryptophan.
- G305 (≠ C293) mutation to S: Decrease in feedback control by tryptophan.
- R402 (≠ N382) mutation to W: Almost no change in feedback control by tryptophan.
- G460 (= G440) mutation to D: Almost no change in feedback control by tryptophan.
- C465 (= C445) mutation to Y: Complete loss of feedback control by tryptophan. 4-fold decrease of affinity binding for chorismate.
Sites not aligning to the query:
- 39 E→K: Complete loss of feedback control by tryptophan.
- 40 binding ; S→F: Complete loss of feedback control by tryptophan.
- 41 A→V: Decrease in feedback control by tryptophan.
- 50 binding
- 128 R→H: Almost no change in feedback control by tryptophan.
- 515 H→Y: Almost no change in feedback control by tryptophan.
P05041 Aminodeoxychorismate synthase component 1; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 1; EC 2.6.1.85 from Escherichia coli (strain K12) (see 4 papers)
33% identity, 78% coverage: 99:492/504 of query aligns to 79:453/453 of P05041
- E258 (= E297) mutation to A: The reaction is extremely slow.; mutation to D: The reaction is extremely slow.
- K274 (≠ A313) mutation to A: Absence of covalent intermediate. Addition of ammonia allows the formation of the covalent intermediate and shows that ammonia can replace the function of K-274. Reduced catalytic efficiency.; mutation to R: Absence of covalent intermediate.; mutation to R: Reduced catalytic efficiency.
- G275 (= G314) mutation to S: Catalytically inactive for both the glutamine-dependent and ammonia-dependent reactions and fails to interact with PabA.
- R311 (= R350) mutation to K: Catalytically active in the NH3-dependent, but inactive for the glutamine-dependent reactions and fails to complex with PabA.
- R316 (= R355) mutation to H: Catalytically inactive for both the glutamine-dependent and ammonia-dependent reactions and fails to interact with PabA.
- S322 (= S361) mutation to T: Complete loss of aminodeoxychorismate synthase activity.
- H339 (= H378) mutation to W: Catalytically inactive for both the glutamine-dependent and ammonia-dependent reactions and fails to interact with PabA.
Sites not aligning to the query:
8hx8A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate (see paper)
33% identity, 88% coverage: 45:489/504 of query aligns to 225:669/673 of 8hx8A
- binding magnesium ion: E521 (= E341), E655 (= E475), E658 (= E478)
- binding tryptophan: L231 (= L51), D232 (≠ E52), S233 (= S53), S241 (≠ A58), F243 (≠ Y63), P458 (= P279), Y459 (≠ F280), G460 (≠ L281), G614 (= G434)
Sites not aligning to the query:
8hx9A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae with chorismate (see paper)
32% identity, 88% coverage: 45:489/504 of query aligns to 183:630/632 of 8hx9A
- binding (3R,4R)-3-[(1-carboxyethenyl)oxy]-4-hydroxycyclohexa-1,5-diene-1-carboxylic acid: I453 (= I312), K454 (≠ A313), G455 (= G314), T456 (= T315), M547 (≠ V406), Y570 (= Y429), R590 (= R449), V603 (≠ A462), G604 (= G463), G605 (≠ A464), A606 (≠ G465), E619 (= E478), K623 (= K482)
- binding tryptophan: L189 (= L51), D190 (≠ E52), S191 (= S53), S199 (≠ A58), F201 (≠ Y63), P419 (= P279), Y420 (≠ F280), G421 (≠ L281), L574 (≠ I433), G575 (= G434)
Sites not aligning to the query:
1k0eA The crystal structure of aminodeoxychorismate synthase from formate grown crystals (see paper)
31% identity, 78% coverage: 99:492/504 of query aligns to 77:437/437 of 1k0eA
- active site: E256 (= E297), K272 (≠ A313), E286 (= E341), H323 (= H378), S350 (≠ T405), W374 (≠ Y429), R394 (= R449), G410 (= G465), E423 (= E478), K427 (= K482)
- binding tryptophan: P238 (= P279), F239 (= F280), S240 (≠ L281)
Sites not aligning to the query:
1k0gA The crystal structure of aminodeoxychorismate synthase from phosphate grown crystals (see paper)
30% identity, 78% coverage: 99:492/504 of query aligns to 79:420/420 of 1k0gA
- active site: E258 (= E297), K274 (= K337), E278 (= E341), S333 (≠ T405), W357 (≠ Y429), R377 (= R449), G393 (= G465), E406 (= E478), K410 (= K482)
- binding phosphate ion: D113 (= D132), R116 (= R135), D347 (= D419), R353 (≠ K425)
- binding tryptophan: P240 (= P279), F241 (= F280), S242 (≠ L281)
Sites not aligning to the query:
1k0gB The crystal structure of aminodeoxychorismate synthase from phosphate grown crystals (see paper)
30% identity, 77% coverage: 99:484/504 of query aligns to 79:409/415 of 1k0gB
- active site: E258 (= E297), K274 (≠ A313), E277 (= E341), S330 (≠ T405), W354 (≠ Y429), R374 (= R449), G390 (= G465), E403 (= E478), K407 (= K482)
- binding phosphate ion: Y112 (= Y131), D113 (= D132), R116 (= R135), D344 (= D419), R350 (≠ K425)
- binding tryptophan: P240 (= P279), F241 (= F280)
Sites not aligning to the query:
6za5B M. Tuberculosis salicylate synthase mbti in complex with salicylate and mg2+ (see paper)
36% identity, 50% coverage: 217:467/504 of query aligns to 162:414/440 of 6za5B
Sites not aligning to the query:
Query Sequence
>WP_015932020.1 NCBI__GCF_000022085.1:WP_015932020.1
MLVTPSLDAAQAAYAAGQPVLLRATLVADLETPVAAFLKLKAGREGAAFLLESVEGGAVR
GRYSMIGLDPDLVWRCSGGTAERADAPDLDRFVPDDRPPLDSLRDLIAESAIPGDAALPP
MAAGLFGYLGYDMVREMERLDPPKPDPIGVPDAILVRPTVMVVFDAVRDEIAVVTPLRPV
PGQPAKAACEAALNRLERVAETLEGPLPVEAWANPTEIPAPAPVSNTTPEEFHAMVARAK
AYIAAGDIFQVVLSQRFEAPFALPAFALYRSLRRVNPAPFLCYLDFGTFQIVCSSPEILV
RVRDGKVTIRPIAGTRRRGATPEEDGALAEELLADPKERAEHLMLLDLGRNDVGRVAQIG
SVTVTDSFFLEYYSQVMHIVSNVEGRLDPRHDALGALVAGFPAGTVSGAPKVRAMQIIDE
LEREKRGPYAGCIGYFGADGQMDTCIVLRTAVVKDGRMHVQAGAGIVHDSDPASEQQECV
NKAKAQFRAAEEAVRFAAQARRGQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory