Comparing WP_015932245.1 NCBI__GCF_000022085.1:WP_015932245.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
4wjiA Crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with NADP and tyrosine
67% identity, 93% coverage: 11:297/309 of query aligns to 7:293/293 of 4wjiA
3ggpA Crystal structure of prephenate dehydrogenase from a. Aeolicus in complex with hydroxyphenyl propionate and NAD+ (see paper)
36% identity, 83% coverage: 13:268/309 of query aligns to 10:263/286 of 3ggpA
3ggoA Crystal structure of prephenate dehydrogenase from a. Aeolicus with hpp and nadh (see paper)
36% identity, 83% coverage: 13:268/309 of query aligns to 10:263/285 of 3ggoA
3gggD The crystal structure of a. Aeolicus prephenate dehydrogenase in complex with tyrosine and NAD+ (see paper)
36% identity, 83% coverage: 13:268/309 of query aligns to 18:271/293 of 3gggD
3b1fA Crystal structure of prephenate dehydrogenase from streptococcus mutans (see paper)
34% identity, 91% coverage: 11:290/309 of query aligns to 9:285/286 of 3b1fA
6u60B Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with NAD and l-tyrosine (see paper)
32% identity, 90% coverage: 10:287/309 of query aligns to 3:279/365 of 6u60B
Sites not aligning to the query:
5uyyA Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with l-tyrosine (see paper)
32% identity, 90% coverage: 10:287/309 of query aligns to 11:287/373 of 5uyyA
Sites not aligning to the query:
2f1kA Crystal structure of synechocystis arogenate dehydrogenase (see paper)
30% identity, 91% coverage: 10:291/309 of query aligns to 2:278/279 of 2f1kA
>WP_015932245.1 NCBI__GCF_000022085.1:WP_015932245.1
MLDHPTRIGRLALVGLGLIGSSIARGARANDLVDTIVAIDRDPAVLERVRTLGLADHVTD
DLAAGVAEADLVILCVPVGAVGPVTAALAGALKPGAILSDVGSVKGAVMAAAAPHVPDHA
AFVPAHPVAGTEQSGPDAGFATLFQGRWCILTPPEGTPPEAVARVRGFWEGLGSVVETMT
AAHHDLVLAITSHVPHLIAYNIVGTAADLETVTQSEVIKFSAGGFRDFTRIAASDPTMWR
DVFLNNKEAVLEVLGRFNEDLAALARAIRWDDGDALHALFTRTRAIRRGIVAMGQETAEP
DFGRRGAKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory