Comparing WP_015933584.1 NCBI__GCF_000022085.1:WP_015933584.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1vpeA Crystallographic analysis of phosphoglycerate kinase from the hyperthermophilic bacterium thermotoga maritima (see paper)
47% identity, 97% coverage: 12:398/398 of query aligns to 9:395/398 of 1vpeA
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
47% identity, 97% coverage: 12:396/398 of query aligns to 10:394/654 of P36204
1phpA Structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms (see paper)
48% identity, 98% coverage: 5:396/398 of query aligns to 4:391/394 of 1phpA
P18912 Phosphoglycerate kinase; EC 2.7.2.3 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
48% identity, 98% coverage: 5:396/398 of query aligns to 4:391/394 of P18912
4feyA An x-ray structure of a putative phosphogylcerate kinase with bound adp from francisella tularensis subsp. Tularensis schu s4
46% identity, 99% coverage: 4:397/398 of query aligns to 3:387/392 of 4feyA
P40924 Phosphoglycerate kinase; EC 2.7.2.3 from Bacillus subtilis (strain 168) (see paper)
46% identity, 99% coverage: 5:397/398 of query aligns to 4:392/394 of P40924
4ng4B Structure of phosphoglycerate kinase (cbu_1782) from coxiella burnetii (see paper)
45% identity, 97% coverage: 12:396/398 of query aligns to 9:384/389 of 4ng4B
P07378 Phosphoglycerate kinase, glycosomal; Phosphoglycerate kinase C; EC 2.7.2.3 from Trypanosoma brucei brucei (see 2 papers)
43% identity, 97% coverage: 12:396/398 of query aligns to 13:416/440 of P07378
16pkA Phosphoglycerate kinase from trypanosoma brucei bisubstrate analog (see paper)
42% identity, 97% coverage: 12:396/398 of query aligns to 9:412/415 of 16pkA
13pkA Ternary complex of phosphoglycerate kinase from trypanosoma brucei (see paper)
42% identity, 97% coverage: 12:396/398 of query aligns to 9:412/415 of 13pkA
6yjeA Plasmoodium vivax phosphoglycerate kinase bound to nitrofuran inhibitor from peg3350 and ammonium acetate at ph 5.5
41% identity, 98% coverage: 6:396/398 of query aligns to 7:413/416 of 6yjeA
P09041 Phosphoglycerate kinase 2; Phosphoglycerate kinase, testis specific; EC 2.7.2.3 from Mus musculus (Mouse) (see paper)
43% identity, 98% coverage: 6:396/398 of query aligns to 8:414/417 of P09041
1ltkC Crystal structure of phosphoglycerate kinase from plasmodium falciparum, in the open conformation
41% identity, 98% coverage: 6:396/398 of query aligns to 15:421/424 of 1ltkC
2paaA Crystal structure of phosphoglycerate kinase-2 bound to atp and 3pg (see paper)
43% identity, 98% coverage: 6:396/398 of query aligns to 4:410/413 of 2paaA
P0A799 Phosphoglycerate kinase; EC 2.7.2.3 from Escherichia coli (strain K12) (see 3 papers)
44% identity, 97% coverage: 12:397/398 of query aligns to 10:382/387 of P0A799
Sites not aligning to the query:
1zmrA Crystal structure of the e. Coli phosphoglycerate kinase (see paper)
44% identity, 97% coverage: 12:397/398 of query aligns to 9:381/386 of 1zmrA
O60101 Phosphoglycerate kinase; EC 2.7.2.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
43% identity, 97% coverage: 12:396/398 of query aligns to 13:411/414 of O60101
Sites not aligning to the query:
2wzcA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp, 3pg and aluminium tetrafluoride (see paper)
43% identity, 97% coverage: 9:396/398 of query aligns to 8:402/405 of 2wzcA
2wzbA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp, 3pg and magnesium trifluoride (see paper)
43% identity, 97% coverage: 9:396/398 of query aligns to 8:402/405 of 2wzbA
4axxA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp 3-phosphoglycerate and beryllium trifluoride
43% identity, 97% coverage: 9:396/398 of query aligns to 8:404/407 of 4axxA
>WP_015933584.1 NCBI__GCF_000022085.1:WP_015933584.1
MTRFRTLDDAGDLKGKRVLVRVDLNVPMENGRVTDATRITRVLPTIREIAEAGGRVVLLA
HFGRPKGKPDPKESLRPIAEAVAKDLGRPVAFAEDCIGPKAAEAVAALGDGGVAMLENTR
FHAGEEKNDPAFVQALAANGDVYVNEAFSASHRAHASTEGLAHVLPAYAGRLMQAEIEAL
TKGLEAPARPVVAIVGGSKVSTKIDLLVNLVGKVDALVIGGGMANTFLHATGLGVGRSLC
ERDLAGTALRIIEAAREKNCAIILPVDAVVAEEFKANAPHHTYGIDAIPESGMILDVGAQ
SVERVAAALNDAKTLVWNGPLGAFEFPPFDQGTVAAARHAAERTKAGKLVSVAGGGDTVA
ALNHAGVAEAFTYVSTAGGAFLEWLEGKPLPGVDALRV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory