Comparing WP_015944380.1 NCBI__GCF_000021925.1:WP_015944380.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2x5dD Crystal structure of a probable aminotransferase from pseudomonas aeruginosa (see paper)
39% identity, 97% coverage: 13:388/388 of query aligns to 1:379/380 of 2x5dD
6l1lB Apo-bacf structure from bacillus subtillis (see paper)
43% identity, 93% coverage: 22:382/388 of query aligns to 25:386/393 of 6l1lB
6l1oB Product bound bacf structure from bacillus subtillis (see paper)
43% identity, 93% coverage: 22:382/388 of query aligns to 25:386/392 of 6l1oB
Sites not aligning to the query:
6l1nA Substrate bound bacf structure from bacillus subtillis (see paper)
42% identity, 92% coverage: 26:382/388 of query aligns to 28:385/393 of 6l1nA
Sites not aligning to the query:
2o1bA Structure of aminotransferase from staphylococcus aureus
35% identity, 91% coverage: 31:383/388 of query aligns to 21:371/376 of 2o1bA
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
31% identity, 94% coverage: 19:384/388 of query aligns to 13:382/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
31% identity, 94% coverage: 19:384/388 of query aligns to 13:382/388 of 1gd9A
5wmhA Arabidopsis thaliana prephenate aminotransferase (see paper)
30% identity, 98% coverage: 5:384/388 of query aligns to 5:396/399 of 5wmhA
5wmlA Arabidopsis thaliana prephenate aminotransferase mutant- k306a (see paper)
30% identity, 98% coverage: 5:384/388 of query aligns to 6:397/404 of 5wmlA
5wmiA Arabidopsis thaliana prephenate aminotransferase mutant- t84v (see paper)
30% identity, 98% coverage: 5:384/388 of query aligns to 6:396/402 of 5wmiA
3jtxB Crystal structure of aminotransferase (np_283882.1) from neisseria meningitidis z2491 at 1.91 a resolution
31% identity, 88% coverage: 28:369/388 of query aligns to 28:377/393 of 3jtxB
Q58097 (5-formylfuran-3-yl)methyl phosphate transaminase; 4-HFC-P:alanine aminotransferase; EC 2.6.1.108 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
28% identity, 99% coverage: 1:384/388 of query aligns to 1:368/370 of Q58097
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
27% identity, 94% coverage: 19:383/388 of query aligns to 24:394/402 of P14909
Sites not aligning to the query:
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
29% identity, 99% coverage: 1:384/388 of query aligns to 9:382/384 of 1o4sB
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
29% identity, 98% coverage: 3:384/388 of query aligns to 5:382/382 of 1b5oA
Q02635 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.79 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
28% identity, 99% coverage: 3:386/388 of query aligns to 5:398/400 of Q02635
6f77A Crystal structure of the prephenate aminotransferase from rhizobium meliloti (see paper)
28% identity, 99% coverage: 3:386/388 of query aligns to 4:397/399 of 6f77A
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
29% identity, 98% coverage: 3:384/388 of query aligns to 5:382/385 of Q56232
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
29% identity, 98% coverage: 3:384/388 of query aligns to 5:382/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
29% identity, 98% coverage: 3:384/388 of query aligns to 5:382/382 of 1bjwA
>WP_015944380.1 NCBI__GCF_000021925.1:WP_015944380.1
MKARRLSSLGASVFTEMDDLRKELEKAGKQLINLSIGSPDRSPSAEIRKVLAEGVLDGGS
YGYTLTRGTESFRSGCARWYKERFGVNLDPEKEVLPLMGSQDGLAHIFLALCDPGDVALI
PDPGYPIYTAGLVLAGGEKVALPLREENGFLPDLSAIEDEVAQQAKIMFLNYPNNPTAAV
APLSFFEEVVDFARRNRIVVCHDAAYSELAFDGYRPVSFLQVPGAKEVGIEFHSVSKTYN
LAGVRLGFAVGNGEIIGALAELKSNIDYGVFEPALQAGAYALSASQENVEQNRRAYQERR
DIWVKGCAQAGWSMPSPRGSMFIWAPVPTAQDSRSFAFALAREAGVIVVPGVAFGEYGEG
YVRIGMVQDQEVLQEAVRRVQEFLAAQG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory