Comparing WP_015944587.1 NCBI__GCF_000021925.1:WP_015944587.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
2f1kA Crystal structure of synechocystis arogenate dehydrogenase (see paper)
31% identity, 90% coverage: 23:294/303 of query aligns to 5:278/279 of 2f1kA
5uyyA Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with l-tyrosine (see paper)
29% identity, 93% coverage: 16:297/303 of query aligns to 7:294/373 of 5uyyA
Sites not aligning to the query:
6u60B Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with NAD and l-tyrosine (see paper)
29% identity, 92% coverage: 18:297/303 of query aligns to 1:286/365 of 6u60B
Sites not aligning to the query:
3ggoA Crystal structure of prephenate dehydrogenase from a. Aeolicus with hpp and nadh (see paper)
26% identity, 90% coverage: 21:293/303 of query aligns to 8:285/285 of 3ggoA
3ggpA Crystal structure of prephenate dehydrogenase from a. Aeolicus in complex with hydroxyphenyl propionate and NAD+ (see paper)
26% identity, 90% coverage: 21:293/303 of query aligns to 8:285/286 of 3ggpA
3gggD The crystal structure of a. Aeolicus prephenate dehydrogenase in complex with tyrosine and NAD+ (see paper)
26% identity, 90% coverage: 21:293/303 of query aligns to 16:293/293 of 3gggD
4wjiA Crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with NADP and tyrosine
29% identity, 90% coverage: 22:295/303 of query aligns to 8:288/293 of 4wjiA
3b1fA Crystal structure of prephenate dehydrogenase from streptococcus mutans (see paper)
28% identity, 89% coverage: 23:293/303 of query aligns to 11:285/286 of 3b1fA
2pv7B Crystal structure of chorismate mutase / prephenate dehydrogenase (tyra) (1574749) from haemophilus influenzae rd at 2.00 a resolution (see paper)
21% identity, 87% coverage: 25:287/303 of query aligns to 17:259/280 of 2pv7B
Sites not aligning to the query:
>WP_015944587.1 NCBI__GCF_000021925.1:WP_015944587.1
MEKGREIILSGGWTGQRQPRACVIGLGLIGGSWAGALAGQGWSVCAVECHEESLKEAKVR
EWIKEGWQEIPESLDVDLVILATPVSLLAESFARAVGCVSAGSLITDVGSVKIDICRAAN
QMNSVYFIGGHPMTGSEQQGFQAAKPNLFQGYPYVITPPPSCPQEMVEKFSQLVQRLGAR
IVSREAEDHDDEVALISHLPHVLSLALALTAAEGNLRGKPLEIAGRSFREITRLVDSSPE
MWRDILFSNASAILRSLDIWEEKVKEIREIIAGADGEEMLKVFARAQGARSQMLNRRESD
ANK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory