Comparing WP_017548294.1 NCBI__GCF_000330705.1:WP_017548294.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
1j6tA Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
31% identity, 90% coverage: 15:145/146 of query aligns to 15:144/144 of 1j6tA
P00550 PTS system mannitol-specific EIICBA component; EIICBA-Mtl; EII-Mtl; EC 2.7.1.197 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 90% coverage: 15:145/146 of query aligns to 507:636/637 of P00550
Sites not aligning to the query:
C0H3V2 Mannitol-specific phosphotransferase enzyme IIA component; EIIA; EIII; PTS system mannitol-specific EIIA component from Bacillus subtilis (strain 168) (see paper)
32% identity, 100% coverage: 1:146/146 of query aligns to 1:143/143 of C0H3V2
O31645 PTS system mannose-specific EIIBCA component; EIIBCA-Man; EII-Man; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see 2 papers)
25% identity, 86% coverage: 20:144/146 of query aligns to 529:648/650 of O31645
Sites not aligning to the query:
>WP_017548294.1 NCBI__GCF_000330705.1:WP_017548294.1
MKFLTEKLIDAEFDASDAEEAIHRAGTLLANADGVEHQYIEAMIRSYRENGSYFVLSPKI
ALPHARPEDGVKDASVSLVKLKSPVEFGHKTNDPVSLVFGLGATSGDEHLEILQKLTRLL
NEKEAADELINAKSIDEIINIIEKRN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory