SitesBLAST
Comparing WP_017549001.1 NCBI__GCF_000330705.1:WP_017549001.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q04797 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Bacillus subtilis (strain 168) (see paper)
45% identity, 98% coverage: 2:322/326 of query aligns to 5:340/346 of Q04797
- S98 (= S96) modified: Phosphoserine
- Y146 (≠ F142) modified: Phosphotyrosine
3q11A Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with NADP and aspartyl beta- difluorophosphonate (see paper)
44% identity, 99% coverage: 4:325/326 of query aligns to 4:343/358 of 3q11A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (= T10), G11 (= G11), A35 (≠ S35), S36 (= S36), R38 (= R38), S39 (= S39), T56 (= T57), A71 (= A72), T75 (= T76), G160 (= G159), M161 (≠ S160), G162 (= G161)
- binding 5,5-difluoro-4-oxo-5-phosphono-D-norvaline: R98 (= R99), N126 (= N125), C127 (= C126), Q154 (= Q153), G158 (= G157), E219 (= E201), K222 (= K204), R244 (= R226)
4r54A Complex crystal structure of sp-aspartate-semialdehyde-dehydrogenase with 3-carboxy-ethyl-phthalic acid (see paper)
44% identity, 99% coverage: 4:325/326 of query aligns to 4:343/357 of 4r54A
- binding 3-(2-carboxyethyl)benzene-1,2-dicarboxylic acid: G72 (= G73), S73 (≠ G74), T94 (≠ S95), S95 (= S96), R98 (= R99), K222 (= K204)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (= T10), G11 (= G11), A12 (≠ V12), V13 (= V13), A35 (≠ S35), S36 (= S36), R38 (= R38), S39 (= S39), T56 (= T57), S70 (= S71), A71 (= A72), G72 (= G73), T75 (= T76), N93 (= N94), T94 (≠ S95), N126 (= N125), C127 (= C126), G160 (= G159), G328 (= G310)
4r41A Complex crystal structure of 4-nitro-2-phosphono-benzoic acid with sp- aspartate-semialdehyde dehydrogenase and nicotinamide-dinucleotide (see paper)
44% identity, 99% coverage: 4:325/326 of query aligns to 4:343/357 of 4r41A
- binding 4-nitro-2-phosphonobenzoic acid: S70 (= S71), G72 (= G73), S73 (≠ G74), N93 (= N94), T94 (≠ S95), S95 (= S96), R98 (= R99), K222 (= K204)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (= T10), G11 (= G11), A12 (≠ V12), A35 (≠ S35), S36 (= S36), R38 (= R38), S39 (= S39), T56 (= T57), A71 (= A72), G160 (= G159), M161 (≠ S160), G162 (= G161)
4r3nA Crystal structure of the ternary complex of sp-asadh with NADP and 1, 2,3-benzenetricarboxylic acid (see paper)
44% identity, 99% coverage: 4:325/326 of query aligns to 4:343/357 of 4r3nA
- active site: C127 (= C126), Q154 (= Q153), R244 (= R226), H251 (= H233)
- binding benzene-1,2,3-tricarboxylic acid: S73 (≠ G74), T94 (≠ S95), S95 (= S96), R98 (= R99), N126 (= N125), K222 (= K204)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (= T10), G11 (= G11), A12 (≠ V12), V13 (= V13), A35 (≠ S35), S36 (= S36), S39 (= S39), T56 (= T57), S70 (= S71), A71 (= A72), G72 (= G73), N93 (= N94), T94 (≠ S95), N126 (= N125), C127 (= C126), G160 (= G159), M161 (≠ S160), G328 (= G310)
3q1lA Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with cysteamine bound covalently to cys 128 (see paper)
44% identity, 99% coverage: 4:325/326 of query aligns to 4:343/357 of 3q1lA
3pwsA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
44% identity, 99% coverage: 4:325/326 of query aligns to 4:343/357 of 3pwsA
- binding (2R)-2-aminohexanedioic acid: R98 (= R99), N126 (= N125), G158 (= G157), I208 (= I190), E219 (= E201), K222 (= K204), R244 (= R226)
- binding adenosine-2'-5'-diphosphate: G8 (= G8), T10 (= T10), G11 (= G11), A12 (≠ V12), A35 (≠ S35), S36 (= S36), R38 (= R38), S39 (= S39), T56 (= T57), A71 (= A72), T75 (= T76), G160 (= G159), M161 (≠ S160)
3pwkA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
44% identity, 99% coverage: 4:325/326 of query aligns to 4:343/357 of 3pwkA
- binding 5'-o-monophosphoryladenylyl(2'->5')adenylyl(2'->5')adenosine: G8 (= G8), T10 (= T10), G11 (= G11), A12 (≠ V12), A35 (≠ S35), S36 (= S36), R38 (= R38), S39 (= S39), T56 (= T57), A71 (= A72), T75 (= T76), G160 (= G159)
- binding trans-cyclohexane-1,4-dicarboxylic acid: R98 (= R99), N126 (= N125), G158 (= G157), A159 (≠ S158), E219 (= E201), K222 (= K204), R244 (= R226)
2gz3A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP and aspartate- semialdehyde (see paper)
44% identity, 99% coverage: 4:325/326 of query aligns to 4:343/357 of 2gz3A
- active site: C127 (= C126), Q154 (= Q153), R244 (= R226), H251 (= H233)
- binding (2r)-2-amino-4-oxobutanoic acid: C127 (= C126), Q154 (= Q153), G158 (= G157), E219 (= E201), R244 (= R226), H251 (= H233)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (= T10), G11 (= G11), A12 (≠ V12), V13 (= V13), A35 (≠ S35), S36 (= S36), R38 (= R38), S39 (= S39), T56 (= T57), S70 (= S71), A71 (= A72), G72 (= G73), T75 (= T76), N93 (= N94), G158 (= G157), G160 (= G159), M161 (≠ S160), N324 (= N306), A329 (= A311)
2gz2A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with 2',5'-adp (see paper)
44% identity, 99% coverage: 4:325/326 of query aligns to 4:343/357 of 2gz2A
- active site: C127 (= C126), Q154 (= Q153), R244 (= R226), H251 (= H233)
- binding adenosine-2'-5'-diphosphate: G8 (= G8), T10 (= T10), G11 (= G11), A35 (≠ S35), S36 (= S36), R38 (= R38), S39 (= S39), T56 (= T57), A71 (= A72), T75 (= T76)
2gz1A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP (see paper)
44% identity, 99% coverage: 4:325/326 of query aligns to 4:343/357 of 2gz1A
- active site: C127 (= C126), Q154 (= Q153), R244 (= R226), H251 (= H233)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (= T10), G11 (= G11), A12 (≠ V12), V13 (= V13), A35 (≠ S35), S36 (= S36), R38 (= R38), S39 (= S39), T56 (= T57), S70 (= S71), A71 (= A72), G72 (= G73), T75 (= T76), N93 (= N94), S157 (= S156), G158 (= G157), G160 (= G159), M161 (≠ S160), N324 (= N306), L325 (≠ I307)
4r51A Crystal complex structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide adenine dinucleotide phosphate and phthalic acid (see paper)
44% identity, 99% coverage: 4:325/326 of query aligns to 4:343/360 of 4r51A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (= T10), G11 (= G11), A12 (≠ V12), V13 (= V13), A35 (≠ S35), S36 (= S36), S39 (= S39), T56 (= T57), S70 (= S71), A71 (= A72), G72 (= G73), N93 (= N94), T94 (≠ S95), N126 (= N125), C127 (= C126), G160 (= G159), M161 (≠ S160), G328 (= G310)
- binding phthalic acid: S73 (≠ G74), T94 (≠ S95), S95 (= S96), R98 (= R99), N126 (= N125), K222 (= K204)
4r5hA Crystal structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide-adenine-dinucleotide-phosphate and 3-carboxy-propenyl- phthalic acid (see paper)
44% identity, 99% coverage: 4:325/326 of query aligns to 4:343/359 of 4r5hA
- binding 3-[(1E)-3-carboxyprop-1-en-1-yl]benzene-1,2-dicarboxylic acid: S73 (≠ G74), T94 (≠ S95), S95 (= S96), R98 (= R99), N126 (= N125), C127 (= C126), Q154 (= Q153), G158 (= G157), K222 (= K204), R244 (= R226), H251 (= H233)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (= T10), G11 (= G11), A12 (≠ V12), V13 (= V13), A35 (≠ S35), S36 (= S36), R38 (= R38), S39 (= S39), T56 (= T57), S70 (= S71), A71 (= A72), G72 (= G73), T75 (= T76), N93 (= N94), T94 (≠ S95), P125 (= P124), N126 (= N125), C127 (= C126), G160 (= G159), M161 (≠ S160), G328 (= G310)
4r4jA Crystal structure of complex sp_asadh with 3-carboxypropyl-phthalic acid and nicotinamide adenine dinucleotide phosphate (see paper)
44% identity, 99% coverage: 4:325/326 of query aligns to 4:343/359 of 4r4jA
- binding 3-(3-carboxypropyl)benzene-1,2-dicarboxylic acid: T94 (≠ S95), S95 (= S96), R98 (= R99), N126 (= N125), C127 (= C126), Q154 (= Q153), G158 (= G157), E219 (= E201), K222 (= K204), R244 (= R226), H251 (= H233)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (= T10), G11 (= G11), A12 (≠ V12), V13 (= V13), A35 (≠ S35), S36 (= S36), R38 (= R38), S39 (= S39), T56 (= T57), S70 (= S71), A71 (= A72), G72 (= G73), T75 (= T76), N93 (= N94), T94 (≠ S95), N126 (= N125), C127 (= C126), G160 (= G159), M161 (≠ S160), G328 (= G310)
3pyxB Crystals structure of aspartate beta-semialdehyde dehydrogenase complex with NADP and 2-aminoterephthalate (see paper)
44% identity, 99% coverage: 4:325/326 of query aligns to 4:343/359 of 3pyxB
- binding 2-aminobenzene-1,4-dicarboxylic acid: R98 (= R99), G158 (= G157), E219 (= E201), K222 (= K204), R244 (= R226)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (= T10), G11 (= G11), A12 (≠ V12), V13 (= V13), A35 (≠ S35), S36 (= S36), R38 (= R38), S39 (= S39), T56 (= T57), S70 (= S71), A71 (= A72), G72 (= G73), T75 (= T76), C127 (= C126), S157 (= S156), G158 (= G157), G160 (= G159), M161 (≠ S160), N324 (= N306), L325 (≠ I307)
3pylC Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with d-2,3-diaminopropionate (see paper)
44% identity, 99% coverage: 4:325/326 of query aligns to 4:343/361 of 3pylC
8jusA Crystal structure of aspartate semialdehyde dehydrogenase from porphyromonas gingivalis complexed with 2',5'adenosine diphosphate
44% identity, 99% coverage: 2:325/326 of query aligns to 1:332/335 of 8jusA
P23247 Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see paper)
41% identity, 97% coverage: 4:318/326 of query aligns to 7:328/337 of P23247
- C132 (= C126) active site, Acyl-thioester intermediate
2r00C Crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae (see paper)
41% identity, 97% coverage: 4:318/326 of query aligns to 6:327/336 of 2r00C
3tz6A Crystal structure of aspartate semialdehyde dehydrogenase complexed with inhibitor smcs (cys) and phosphate from mycobacterium tuberculosis h37rv (see paper)
39% identity, 97% coverage: 4:318/326 of query aligns to 4:336/342 of 3tz6A
- active site: C129 (= C126), Q156 (= Q153), R248 (= R226), H255 (= H233)
- binding cysteine: C129 (= C126), Q156 (= Q153), G160 (= G157), E223 (= E201), R248 (= R226), H255 (= H233)
- binding glycerol: S108 (≠ P109), G187 (= G172), F192 (vs. gap), P201 (= P181), Q225 (= Q203), R228 (≠ I206), F229 (≠ D207), Q335 (= Q317)
- binding sulfate ion: R98 (= R99), H117 (≠ P114), R119 (≠ L116), N128 (= N125), C129 (= C126), K226 (= K204), E270 (= E248), R273 (= R251)
Sites not aligning to the query:
Query Sequence
>WP_017549001.1 NCBI__GCF_000330705.1:WP_017549001.1
MVRVAIVGATGVVGTKMIEMFEQYGIKADEITLLSSARSAGKSLQVMGEELTVQELTEET
PKQGFDYVVMSAGGSTSRQFAPLFEENGSIVIDNSSQWRMHEDIDLIVPEINAPKLDRKI
IANPNCSTIQSVVALQPLKEKFGLKRVNYTTYQAVSGSGSGGLRDLEEGARGEAPTTYPR
PIYDNVLPHIDVFLENGYTKEEQKMIDETRKILGLPDLAVSATCVRVPVSNSHSVHMNVT
LENEATEEEVRDAFRNIPHIMLLDNPESNEYPTPLESTGRPEVFVGRIRRDDSLGNTFHV
WCTADNILKGAAQNSVQILKQIMERE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory