Comparing WP_017549241.1 NCBI__GCF_000330705.1:WP_017549241.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00903 Aminodeoxychorismate synthase component 2; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 2; Aminodeoxychorismate synthase, glutamine amidotransferase component; EC 2.6.1.85 from Escherichia coli (strain K12) (see paper)
55% identity, 96% coverage: 1:185/192 of query aligns to 1:185/187 of P00903
Q42565 Anthranilate synthase beta subunit 1, chloroplastic; Anthranilate synthase component 2-1; Anthranilate synthase, glutamine amidotransferase component 2-1; Protein TRYPTOPHAN BIOSYNTHESIS 4; Protein WEAK ETHYLENE INSENSITIVE 7; EC 4.1.3.27 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
43% identity, 99% coverage: 2:191/192 of query aligns to 75:270/276 of Q42565
P00900 Anthranilate synthase component 2; AS; ASII; Anthranilate synthase, GATase component; Anthranilate synthase, glutamine amidotransferase component; EC 4.1.3.27 from Serratia marcescens (see 3 papers)
40% identity, 99% coverage: 2:191/192 of query aligns to 4:193/193 of P00900
Sites not aligning to the query:
8hx8A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate (see paper)
42% identity, 94% coverage: 4:183/192 of query aligns to 8:186/673 of 8hx8A
Sites not aligning to the query:
1i7qB Anthranilate synthase from s. Marcescens (see paper)
40% identity, 99% coverage: 2:191/192 of query aligns to 3:192/192 of 1i7qB
8hx9A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae with chorismate (see paper)
35% identity, 94% coverage: 4:183/192 of query aligns to 7:143/632 of 8hx9A
Sites not aligning to the query:
2ywcA Crystal structure of gmp synthetase from thermus thermophilus in complex with xmp
32% identity, 99% coverage: 1:191/192 of query aligns to 1:187/475 of 2ywcA
Sites not aligning to the query:
Q9LVW7 Carbamoyl phosphate synthase small chain, chloroplastic; Carbamoyl phosphate synthetase glutamine chain; Protein VENOSA 6; EC 6.3.5.5 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 97% coverage: 3:189/192 of query aligns to 242:424/430 of Q9LVW7
7yc6A Crystal structure of d110p mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase
31% identity, 95% coverage: 1:183/192 of query aligns to 1:173/183 of 7yc6A
5tw7F Crystal structure of a gmp synthase (glutamine-hydrolyzing) from neisseria gonorrhoeae
30% identity, 76% coverage: 36:181/192 of query aligns to 39:184/490 of 5tw7F
Sites not aligning to the query:
1ce8B Carbamoyl phosphate synthetase from escherichis coli with complexed with the allosteric ligand imp (see paper)
29% identity, 92% coverage: 14:189/192 of query aligns to 203:374/379 of 1ce8B
Sites not aligning to the query:
P0A6F1 Carbamoyl phosphate synthase small chain; Carbamoyl phosphate synthetase glutamine chain; EC 6.3.5.5 from Escherichia coli (strain K12) (see paper)
29% identity, 92% coverage: 14:189/192 of query aligns to 204:375/382 of P0A6F1
Sites not aligning to the query:
P05990 Multifunctional protein r; Protein rudimentary; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Drosophila melanogaster (Fruit fly) (see 2 papers)
30% identity, 80% coverage: 39:191/192 of query aligns to 227:377/2224 of P05990
Sites not aligning to the query:
4wioA Crystal structure of the c89a gmp synthetase inactive mutant from plasmodium falciparum in complex with glutamine (see paper)
26% identity, 81% coverage: 34:188/192 of query aligns to 34:217/525 of 4wioA
Sites not aligning to the query:
1c3oB Crystal structure of the carbamoyl phosphate synthetase: small subunit mutant c269s with bound glutamine (see paper)
28% identity, 92% coverage: 14:189/192 of query aligns to 203:374/379 of 1c3oB
Sites not aligning to the query:
P27708 Multifunctional protein CAD; Carbamoyl phosphate synthetase 2-aspartate transcarbamylase-dihydroorotase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Homo sapiens (Human) (see 7 papers)
28% identity, 93% coverage: 11:189/192 of query aligns to 185:358/2225 of P27708
Sites not aligning to the query:
P08955 Multifunctional protein CAD; Carbamoyl phosphate synthetase 2-aspartate transcarbamylase-dihydroorotase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Mesocricetus auratus (Golden hamster) (see paper)
27% identity, 93% coverage: 11:189/192 of query aligns to 185:358/2225 of P08955
Sites not aligning to the query:
1gpmA Escherichia coli gmp synthetase complexed with amp and pyrophosphate (see paper)
24% identity, 97% coverage: 2:188/192 of query aligns to 8:199/501 of 1gpmA
Sites not aligning to the query:
Q18990 Multifunctional protein pyr-1; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Caenorhabditis elegans (see 3 papers)
32% identity, 66% coverage: 45:170/192 of query aligns to 219:341/2198 of Q18990
Sites not aligning to the query:
P07258 Carbamoyl phosphate synthase arginine-specific small chain; CPS; CPSase; CPSase-arg; Arginine-specific carbamoyl phosphate synthetase, glutamine chain; Carbamoyl phosphate synthase A; CPS-A; Glutamine-dependent carbamoyl phosphate synthetase; EC 6.3.5.5 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
30% identity, 83% coverage: 14:173/192 of query aligns to 196:354/411 of P07258
>WP_017549241.1 NCBI__GCF_000330705.1:WP_017549241.1
MIYMIDHYDSFTYNIVQFLGECGEDITVRRNDAVQLNEIEALQPDLILLSPGPRTPEQTG
MTLEVIDKFKGILPIFGVCLGHQSIAHAFGGNIVKTGRLMHGKTSQIHHDGIGIFRGIPQ
GTEVMNYHSLVVDRASLPDCFEVSAENEKGEVMAIRHRDFSIEGVQFHPESIGSADGRKM
LENVLEGIKVKI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory