Comparing WP_017549842.1 NCBI__GCF_000330705.1:WP_017549842.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
3dbnA Crystal structure of the streptoccocus suis serotype2 d-mannonate dehydratase in complex with its substrate (see paper)
46% identity, 97% coverage: 1:347/357 of query aligns to 3:331/349 of 3dbnA
3bdkA Crystal structure of streptococcus suis mannonate dehydratase complexed with substrate analogue
46% identity, 97% coverage: 1:347/357 of query aligns to 3:331/349 of 3bdkA
4eayA Crystal structures of mannonate dehydratase from escherichia coli strain k12 complexed with d-mannonate (see paper)
35% identity, 96% coverage: 1:344/357 of query aligns to 3:385/395 of 4eayA
4eacC Crystal structure of mannonate dehydratase from escherichia coli strain k12 (see paper)
35% identity, 96% coverage: 1:344/357 of query aligns to 3:385/396 of 4eacC
>WP_017549842.1 NCBI__GCF_000330705.1:WP_017549842.1
MHMTFRWYGEGNDSVTLDQIKQIPGVEGVVWALHHRQAGEVWPEEEVMEVKKQADAHGFH
LDVVESINVHEDIKLGKASRDEYIENYKISLRNVAKAGARVVCFNFMPVFDWTRTDLFKE
LGDGSTALFYEKSKVENMDPDELIKQTTDSGYTMPGWEPERLKTIEDSFKAYETVDEEQL
WKNMEHFLLEVLPVAEEEGIKMAIHPDDPPWSVFNLPRIINSESAIERYLSISDSPSHCL
TLCSGSLGANPENDIPHIIRRFADRIAFAHIRNVKTYDNGDFIETSHRSRDGSVPIDDVV
RAYHEAGFKGYVRPDHGRHLWDEDCRPGYGLYDRALGIMYLWGLWDAYELEKRKGVG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory