Comparing WP_017550014.1 NCBI__GCF_000330705.1:WP_017550014.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ae8B Crystal structure of imidazoleglycerol-phosphate dehydratase from staphylococcus aureus subsp. Aureus n315
60% identity, 89% coverage: 9:179/192 of query aligns to 7:171/172 of 2ae8B
Q9S5G5 Histidine biosynthesis bifunctional protein HisB; EC 3.1.3.15; EC 4.2.1.19 from Escherichia coli O157:H7 (see paper)
46% identity, 97% coverage: 6:191/192 of query aligns to 173:355/355 of Q9S5G5
Sites not aligning to the query:
O23346 Imidazoleglycerol-phosphate dehydratase 2, chloroplastic; IGPD 2; Protein HISTIDINE BIOSYNTHESIS 5B; EC 4.2.1.19 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
45% identity, 97% coverage: 5:191/192 of query aligns to 81:269/272 of O23346
Sites not aligning to the query:
5el9A A. Thaliana igpd2 in complex with the triazole-phosphonate inhibitor, (s)-c348, to 1.1a resolution (see paper)
45% identity, 97% coverage: 5:191/192 of query aligns to 8:196/199 of 5el9A
5ekwA A. Thaliana igpd2 in complex with the racemate of the triazole- phosphonate inhibitor, c348 (see paper)
45% identity, 96% coverage: 5:189/192 of query aligns to 8:194/194 of 5ekwA
P34047 Imidazoleglycerol-phosphate dehydratase 1, chloroplastic; IGPD 1; Protein HISTIDINE BIOSYNTHESIS 5A; EC 4.2.1.19 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
44% identity, 97% coverage: 5:191/192 of query aligns to 79:267/270 of P34047
6fwhL Acanthamoeba igpd in complex with r-c348 to 1.7a resolution (see paper)
40% identity, 97% coverage: 6:192/192 of query aligns to 8:195/195 of 6fwhL
Sites not aligning to the query:
6fwhA Acanthamoeba igpd in complex with r-c348 to 1.7a resolution (see paper)
40% identity, 97% coverage: 6:192/192 of query aligns to 9:196/196 of 6fwhA
4qnkA The structure of wt a. Thaliana igpd2 in complex with mn2+ and phosphate (see paper)
45% identity, 90% coverage: 5:176/192 of query aligns to 8:178/185 of 4qnkA
4mu1A The structure of wt a. Thaliana igpd2 in complex with mn2+, imidazole, and sulfate at 1.5 a resolution (see paper)
45% identity, 90% coverage: 5:176/192 of query aligns to 8:178/185 of 4mu1A
4mu0A The structure of wt a. Thaliana igpd2 in complex with mn2+ and 1,2,4- triazole at 1.3 a resolution (see paper)
45% identity, 90% coverage: 5:176/192 of query aligns to 8:178/185 of 4mu0A
4mu3A The form a structure of an e21q catalytic mutant of a. Thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution (see paper)
45% identity, 90% coverage: 5:176/192 of query aligns to 8:178/186 of 4mu3A
6ezmU Imidazoleglycerol-phosphate dehydratase from saccharomyces cerevisiae (see paper)
37% identity, 97% coverage: 5:191/192 of query aligns to 7:212/212 of 6ezmU
P06633 Imidazoleglycerol-phosphate dehydratase; IGPD; EC 4.2.1.19 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
42% identity, 85% coverage: 28:191/192 of query aligns to 55:219/220 of P06633
2f1dA X-ray structure of imidazoleglycerol-phosphate dehydratase (see paper)
44% identity, 90% coverage: 5:176/192 of query aligns to 7:177/183 of 2f1dA
8qawA Medicago truncatula hisn5 (igpd) in complex with mn, imd, edo, fmt, gol and trs (see paper)
42% identity, 90% coverage: 5:176/192 of query aligns to 8:178/185 of 8qawA
8qavA Medicago truncatula hisn5 (igpd) in complex with mn and ig2 (see paper)
42% identity, 90% coverage: 5:176/192 of query aligns to 7:177/184 of 8qavA
P40374 Imidazoleglycerol-phosphate dehydratase; IGPD; EC 4.2.1.19 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
35% identity, 97% coverage: 5:191/192 of query aligns to 7:216/216 of P40374
1rhyB Crystal structure of imidazole glycerol phosphate dehydratase (see paper)
40% identity, 90% coverage: 5:177/192 of query aligns to 8:177/180 of 1rhyB
P9WML9 Imidazoleglycerol-phosphate dehydratase; IGPD; EC 4.2.1.19 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
38% identity, 95% coverage: 10:191/192 of query aligns to 21:210/210 of P9WML9
>WP_017550014.1 NCBI__GCF_000330705.1:WP_017550014.1
MIRKERSTQETRISISLDDEKSFKESKISTNVGFFDHMLTLLSFHSELFLEVEADGDNEV
DDHHTVEDVGIILGQLIRELYTEKESYQRYGTTYIPMDESLARVVLDLSGRPHLNFQAEF
SKEKVGTFDTELVLEFFNALSMNSRMTLHIDLLKGGNTHHEIEAVFKAFARSLKAALKAG
GSGIPSSKGVIE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory