SitesBLAST
Comparing WP_017597122.1 NCBI__GCF_000341125.1:WP_017597122.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4omaA The crystal structure of methionine gamma-lyase from citrobacter freundii in complex with l-cycloserine pyridoxal-5'-phosphate (see paper)
44% identity, 99% coverage: 2:389/390 of query aligns to 5:392/396 of 4omaA
- active site: R59 (= R56), Y112 (= Y109), D184 (= D181), K209 (= K206)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: G87 (= G84), I88 (≠ M85), Y112 (= Y109), D184 (= D181), S206 (= S203), T208 (= T205), K209 (= K206), V337 (≠ P334), S338 (= S335), R373 (= R370)
3jwbA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with norleucine (see paper)
44% identity, 99% coverage: 2:389/390 of query aligns to 5:392/396 of 3jwbA
3jwaA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with methionine phosphinate (see paper)
44% identity, 99% coverage: 2:389/390 of query aligns to 5:392/396 of 3jwaA
3jw9A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with s-ethyl-cysteine (see paper)
44% identity, 99% coverage: 2:389/390 of query aligns to 5:392/396 of 3jw9A
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
44% identity, 99% coverage: 2:389/390 of query aligns to 4:391/395 of 5m3zA
- active site: R58 (= R56), Y111 (= Y109), D183 (= D181), K208 (= K206)
- binding norleucine: Y111 (= Y109), H113 (≠ G111), K208 (= K206), V336 (≠ P334), S337 (= S335)
- binding pyridoxal-5'-phosphate: G86 (= G84), I87 (≠ M85), Y111 (= Y109), E154 (= E152), D183 (= D181), T185 (= T183), S205 (= S203), T207 (= T205), K208 (= K206)
- binding 2-[o-phosphonopyridoxyl]-amino-hexanoic acid: G86 (= G84), I87 (≠ M85), Y111 (= Y109), D183 (= D181), S205 (= S203), T207 (= T205), K208 (= K206), V336 (≠ P334), S337 (= S335), R372 (= R370)
6egrA Crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement (see paper)
44% identity, 99% coverage: 2:389/390 of query aligns to 5:392/396 of 6egrA
4hf8A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with glycine (see paper)
44% identity, 99% coverage: 2:389/390 of query aligns to 5:392/396 of 4hf8A
- active site: R59 (= R56), Y112 (= Y109), D184 (= D181), K209 (= K206)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: G87 (= G84), I88 (≠ M85), Y112 (= Y109), E155 (= E152), N159 (= N156), D184 (= D181), S206 (= S203), K209 (= K206), S338 (= S335), R373 (= R370)
5dx5A Crystal structure of methionine gamma-lyase from clostridium sporogenes (see paper)
47% identity, 94% coverage: 23:390/390 of query aligns to 26:395/399 of 5dx5A
- active site: R59 (= R56), Y112 (= Y109), D186 (= D181), K211 (= K206)
- binding pyridoxal-5'-phosphate: Y57 (= Y54), R59 (= R56), S86 (= S83), G87 (= G84), M88 (= M85), Y112 (= Y109), D186 (= D181), F189 (= F184), S208 (= S203), T210 (= T205), K211 (= K206)
3mkjA Methionine gamma-lyase from citrobacter freundii with pyridoximine-5'- phosphate (see paper)
44% identity, 99% coverage: 2:389/390 of query aligns to 5:381/386 of 3mkjA
- active site: Y101 (= Y109), D173 (= D181), K198 (= K206)
- binding [5-hydroxy-4-(iminomethyl)-6-methyl-pyridin-3-yl]methyl dihydrogen phosphate: G76 (= G84), I77 (≠ M85), Y101 (= Y109), E144 (= E152), D173 (= D181), F176 (= F184), S195 (= S203), T197 (= T205), K198 (= K206)
1pg8A Crystal structure of l-methionine alpha-, gamma-lyase
46% identity, 98% coverage: 7:390/390 of query aligns to 12:395/398 of 1pg8A
- active site: R61 (= R56), Y114 (= Y109), D186 (= D181), K211 (= K206)
- binding pyridoxal-5'-phosphate: Y59 (= Y54), R61 (= R56), S88 (= S83), G89 (= G84), M90 (= M85), Y114 (= Y109), D186 (= D181), S208 (= S203), T210 (= T205), K211 (= K206)
P13254 L-methionine gamma-lyase; MGL; Homocysteine desulfhydrase; L-methioninase; EC 4.4.1.11; EC 4.4.1.2 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
46% identity, 98% coverage: 7:390/390 of query aligns to 12:395/398 of P13254
- YSR 59:61 (≠ YAR 54:56) binding
- R61 (= R56) mutation R->A,E,F: Loss of elimination activity against L-methionine.
- GM 89:90 (= GM 84:85) binding in other chain
- Y114 (= Y109) binding
- C116 (≠ G111) mutation to H: Drastic decrease of the catalytic efficiency of the elimination reaction with L-methionine, by 6700-fold, and increases that with L-cysteine by 7-fold, mainly due to changes in kcat. Loss of ability to catalyze replacement reaction between L-methionine and 2-mercaptoethanol.; mutation to S: 9% of wild-type elimination activity against L-methionine.; mutation to T: 40% of wild-type elimination activity against L-methionine.
- SAT 208:210 (= SAT 203:205) binding in other chain
- K211 (= K206) modified: N6-(pyridoxal phosphate)lysine
- K240 (≠ T234) mutation K->D,E: Marked decrease in elimination activity against both L-methionine and DL-homocysteine.; mutation to M: 50% reduction in alpha,gamma-elimination activity against DL-homocysteine, while retaining elimination activity against L-methionine and L-cysteine.
- D241 (≠ N235) mutation D->H,R: 5 to 14-fold reduction in alpha,gamma-elimination activity against L-methionine, while no change in affinity for L-methionine.
- R375 (= R370) binding
5x2xA Crystal structure of pseudomonas putida methionine gamma-lyase wild type with l-homocysteine intermediates (see paper)
46% identity, 98% coverage: 7:390/390 of query aligns to 6:389/392 of 5x2xA
- active site: R55 (= R56), Y108 (= Y109), D180 (= D181), K205 (= K206)
- binding (2E)-2-{[(1E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}but-2-enoic acid: Y53 (= Y54), R55 (= R56), G83 (= G84), M84 (= M85), Y108 (= Y109), N155 (= N156), D180 (= D181), S202 (= S203), T204 (= T205), K205 (= K206), V333 (≠ P334), S334 (= S335), R369 (= R370)
5x2wA Crystal structure of pseudomonas putida methionine gamma-lyase wild type with l-methionine intermediates (see paper)
46% identity, 98% coverage: 7:390/390 of query aligns to 6:389/392 of 5x2wA
- active site: R55 (= R56), Y108 (= Y109), D180 (= D181), K205 (= K206)
- binding (2E)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]-4-(methylsulfanyl)but-2-enoic acid: Y53 (= Y54), R55 (= R56), S82 (= S83), G83 (= G84), M84 (= M85), Y108 (= Y109), D180 (= D181), S202 (= S203), K205 (= K206), V333 (≠ P334), S334 (= S335), R369 (= R370)
5x30C Crystal structure of pseudomonas putida methionine gamma-lyase c116h mutant with l-homocysteine intermediates. (see paper)
46% identity, 98% coverage: 7:390/390 of query aligns to 7:390/393 of 5x30C
3vk3A Crystal structure of l-methionine gamma-lyase from pseudomonas putida c116h mutant complexed with l-methionine (see paper)
46% identity, 98% coverage: 7:390/390 of query aligns to 11:394/397 of 3vk3A
4iyoD Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
47% identity, 90% coverage: 38:389/390 of query aligns to 29:380/384 of 4iyoD
- active site: R47 (= R56), Y99 (= Y109), D172 (= D181), K197 (= K206)
- binding serine: Y45 (= Y54), T48 (≠ Y57), Y99 (= Y109), Y99 (= Y109), R104 (≠ A114), K197 (= K206), N227 (= N235), E325 (≠ P334), S326 (= S335), T341 (≠ S350), R361 (= R370)
4iyoB Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
47% identity, 90% coverage: 38:389/390 of query aligns to 29:380/381 of 4iyoB
- active site: R47 (= R56), Y99 (= Y109), D172 (= D181), K197 (= K206)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: Y45 (= Y54), R47 (= R56)
- binding amino-acrylate: Y99 (= Y109), K197 (= K206), S326 (= S335), T341 (≠ S350), R361 (= R370)
- binding pyruvic acid: Q221 (≠ R229), F224 (≠ E232)
- binding serine: Y45 (= Y54), T48 (≠ Y57), Y99 (= Y109), R104 (≠ A114), N227 (= N235), E325 (≠ P334)
4iy7B Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
47% identity, 90% coverage: 38:389/390 of query aligns to 29:380/381 of 4iy7B
- active site: R47 (= R56), Y99 (= Y109), D172 (= D181), K197 (= K206)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: Y45 (= Y54), R47 (= R56)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-serine: G75 (= G84), M76 (= M85), Y99 (= Y109), E143 (= E152), N147 (= N156), D172 (= D181), S194 (= S203), K197 (= K206), S326 (= S335), L327 (= L336), T341 (≠ S350), R361 (= R370)
- binding pyruvic acid: Q221 (≠ R229), F224 (≠ E232)
- binding serine: Y45 (= Y54), T48 (≠ Y57), Y99 (= Y109), R104 (≠ A114), N227 (= N235), E325 (≠ P334)
4iy7A Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
47% identity, 90% coverage: 38:389/390 of query aligns to 29:380/381 of 4iy7A
- active site: R47 (= R56), Y99 (= Y109), D172 (= D181), K197 (= K206)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: G75 (= G84), M76 (= M85), Y99 (= Y109), E143 (= E152), N147 (= N156), D172 (= D181), S194 (= S203), K197 (= K206), S326 (= S335), L327 (= L336), T341 (≠ S350), R361 (= R370)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-serine: Y45 (= Y54), R47 (= R56)
- binding serine: Y45 (= Y54), T48 (≠ Y57), Y99 (= Y109), R104 (≠ A114), N227 (= N235), E325 (≠ P334)
4ixzA Native structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae at ph 9.0 (see paper)
47% identity, 90% coverage: 38:389/390 of query aligns to 29:380/381 of 4ixzA
Query Sequence
>WP_017597122.1 NCBI__GCF_000341125.1:WP_017597122.1
MTHHAETRTVHQPAPVVEGSTPLGVPIYQAHTFAFPDTETMAASFQGAGSPFVYARYGNP
TVAALEDAVADLEGGAGAIASGSGMGAITATLWALLGTGGHVVAQERLYGGTQALLTTLR
ERWGVEVTQVDAGDPAAVDAALRPDTRVLVLETIANPTGQVADLPALTALARRHGTTVIV
DNTFATPLLCRPIEHGADIVVHSATKYMGGHSDTIGGVAVFADAGTLTRVRERTNEFGAV
MEPFAAWLINRGLSTLGVRMRRHCANAEELARRLDRHPAVTRVHYAGLPDHPGHATAREL
LDGGFGGVLAFELAGGLEAGRSFAERVRLAVLAPSLGDVRTLVMHPASTSHRMLDAEGLA
RAGVSEGLIRLSAGIEDVEDLWADLERALE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory