Comparing WP_017597788.1 NCBI__GCF_000341125.1:WP_017597788.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
39% identity, 93% coverage: 20:291/292 of query aligns to 1:274/367 of P0A7B5
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
40% identity, 92% coverage: 22:291/292 of query aligns to 1:272/365 of 2j5tD
Sites not aligning to the query:
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
37% identity, 85% coverage: 24:271/292 of query aligns to 1:240/241 of 2akoA
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
35% identity, 92% coverage: 22:291/292 of query aligns to 1:232/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
35% identity, 92% coverage: 22:291/292 of query aligns to 1:230/323 of 2j5vA
8j0gB Gk monomer complexes with glutamate and atp
36% identity, 87% coverage: 17:271/292 of query aligns to 1:267/274 of 8j0gB
8j0eB Gk monomer complexes with catalytic intermediate
37% identity, 87% coverage: 17:271/292 of query aligns to 4:262/269 of 8j0eB
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
33% identity, 87% coverage: 17:271/292 of query aligns to 6:256/258 of 7wx3B
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
33% identity, 87% coverage: 17:271/292 of query aligns to 6:234/236 of 7f5xA
8j0fA Gk tetramer with adjacent hooks at reaction state
35% identity, 93% coverage: 17:287/292 of query aligns to 5:270/270 of 8j0fA
8u0mA Crystal structure of isopentenyl phosphate kinase from thermococcus paralvinellae bound to (e)-2-methylbut-2-en-1-yl monophosphate and atp (see paper)
25% identity, 45% coverage: 140:269/292 of query aligns to 120:241/247 of 8u0mA
Sites not aligning to the query:
>WP_017597788.1 NCBI__GCF_000341125.1:WP_017597788.1
MDSVRTEHIDELEVAGRKAVANARRVVVKVGSSSLTTPEGRIDSSRIRDLVEVLAARRAL
GQEVILVSSGAVAAGMTPLGLTRRPRDLASQQAAASVGQGLLLASYTAELAGHGLTAAQV
LLTVEDMMRRVQHRNAQRTLRRLLDIGAVPIVNENDTVATHEIRFGDNDRLAALVAHLLR
ADALVLLSDVDALYDGNPSDPSTSVVDLVRGPGDLDGIDIGGAGKRGVGTGGMVTKVESA
RIATEAGVQTVLTSAANARAALAGERVGTLFAPAEGRRPSTRQLWLPPPPPP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory