Comparing WP_017598182.1 NCBI__GCF_000341125.1:WP_017598182.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
41% identity, 95% coverage: 14:396/405 of query aligns to 9:386/395 of 5m3zA
4omaA The crystal structure of methionine gamma-lyase from citrobacter freundii in complex with l-cycloserine pyridoxal-5'-phosphate (see paper)
41% identity, 95% coverage: 14:396/405 of query aligns to 10:387/396 of 4omaA
3jwbA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with norleucine (see paper)
41% identity, 95% coverage: 14:396/405 of query aligns to 10:387/396 of 3jwbA
3jwaA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with methionine phosphinate (see paper)
41% identity, 95% coverage: 14:396/405 of query aligns to 10:387/396 of 3jwaA
3jw9A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with s-ethyl-cysteine (see paper)
41% identity, 95% coverage: 14:396/405 of query aligns to 10:387/396 of 3jw9A
6egrA Crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement (see paper)
41% identity, 95% coverage: 14:396/405 of query aligns to 10:387/396 of 6egrA
4hf8A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with glycine (see paper)
41% identity, 95% coverage: 14:396/405 of query aligns to 10:387/396 of 4hf8A
3mkjA Methionine gamma-lyase from citrobacter freundii with pyridoximine-5'- phosphate (see paper)
40% identity, 95% coverage: 14:396/405 of query aligns to 10:376/386 of 3mkjA
5dx5A Crystal structure of methionine gamma-lyase from clostridium sporogenes (see paper)
40% identity, 91% coverage: 33:402/405 of query aligns to 29:395/399 of 5dx5A
3aeoA Reaction intermediate structure of entamoeba histolytica methionine gamma-lyase 1 containing methionine alpha, beta-enamine-pyridoxamine- 5'-phosphate
39% identity, 91% coverage: 33:402/405 of query aligns to 23:385/387 of 3aeoA
3aelA Reaction intermediate structure of entamoeba histolytica methionine gamma-lyase 1 containing methionine imine-pyridoxamine-5'-phosphate and alpha-amino-alpha, beta-butenoic acid-pyridoxal-5'-phosphate
39% identity, 91% coverage: 33:402/405 of query aligns to 23:385/387 of 3aelA
3aejC Reaction intermediate structure of entamoeba histolytica methionine gamma-lyase 1 tetramer containing michaelis complex and methionine- pyridoxal-5'-phosphate
39% identity, 91% coverage: 33:402/405 of query aligns to 23:385/387 of 3aejC
3aejA Reaction intermediate structure of entamoeba histolytica methionine gamma-lyase 1 tetramer containing michaelis complex and methionine- pyridoxal-5'-phosphate
39% identity, 91% coverage: 33:402/405 of query aligns to 23:385/387 of 3aejA
3vk3A Crystal structure of l-methionine gamma-lyase from pseudomonas putida c116h mutant complexed with l-methionine (see paper)
41% identity, 92% coverage: 33:403/405 of query aligns to 30:395/397 of 3vk3A
4iyoD Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
42% identity, 96% coverage: 14:401/405 of query aligns to 6:380/384 of 4iyoD
5x30C Crystal structure of pseudomonas putida methionine gamma-lyase c116h mutant with l-homocysteine intermediates. (see paper)
41% identity, 92% coverage: 33:403/405 of query aligns to 26:391/393 of 5x30C
4iyoB Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
42% identity, 96% coverage: 14:401/405 of query aligns to 6:380/381 of 4iyoB
4iy7B Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
42% identity, 96% coverage: 14:401/405 of query aligns to 6:380/381 of 4iy7B
4iy7A Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
42% identity, 96% coverage: 14:401/405 of query aligns to 6:380/381 of 4iy7A
4ixzA Native structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae at ph 9.0 (see paper)
42% identity, 96% coverage: 14:401/405 of query aligns to 6:380/381 of 4ixzA
>WP_017598182.1 NCBI__GCF_000341125.1:WP_017598182.1
MPHVPAPGPETEFTRALNLPSAPVPAERPMRMPVHRATTYEFHTSQEYADVLAGTQEGYS
YARIDSPTVDAFAEGVAALEGAGLRTRVRGQAFASGMAAISTVLMALTEAGAHVVAARSI
YGNTHSLLGGLLRRFGVRTDFVDVTDLDAVRAAVRPDTAVLFTETLSNPTMAVSDLPELA
RIAREAGATLVVDSTFASPVVCRPLEHGADVVVHSATKFIGGHSDATGGVAVAAPELIDR
IRAARIDLGPCLAPDEAYLLHRGLETLPLRVARQCESAAAFAAALEGHSAVERVDHPSLA
SHPQTELAAKLFDAGRCGAVVTVHPRGGQEAGMRFADRIRLGTVAASLGGTHTLVGHVAS
TTHRQMSETELADAGISPGAVRFSIGLEDPQDLIDDALAALDADI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory