SitesBLAST
Comparing WP_017599310.1 NCBI__GCF_000341125.1:WP_017599310.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6nmxA Threonine synthase from bacillus subtilis atcc 6633 with plp and appa (see paper)
35% identity, 80% coverage: 65:399/419 of query aligns to 7:327/350 of 6nmxA
- active site: K60 (= K120), T84 (= T144), E216 (≠ Q282), S220 (≠ C286), A238 (≠ S311), T315 (= T388)
- binding (2E,3Z)-2-{[(Z)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4(1H)-ylidene}methyl]imino}-5-phosphonopent-3-enoic acid: K60 (= K120), S83 (= S143), T84 (= T144), N86 (= N146), T87 (≠ L147), F133 (≠ Y192), N153 (= N215), S154 (≠ N217), R159 (≠ Y222), V185 (≠ I249), G186 (≠ A250), N187 (≠ S251), A188 (≠ G252), G189 (≠ S253), N190 (≠ Q254), A238 (≠ S311), I239 (≠ L312), E285 (= E358), T315 (= T388)
6cgqB Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
35% identity, 80% coverage: 65:399/419 of query aligns to 5:325/345 of 6cgqB
- active site: K58 (= K120), T82 (= T144), E214 (≠ Q282), S218 (≠ C286), A236 (≠ S311), T313 (= T388)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-alanine: K58 (= K120), S81 (= S143), T82 (= T144), N84 (= N146), T85 (≠ L147), V183 (≠ I249), G184 (≠ A250), N185 (≠ S251), A186 (≠ G252), N188 (≠ Q254), A236 (≠ S311), I237 (≠ L312), E283 (= E358), T313 (= T388)
- binding phosphate ion: K58 (= K120), T85 (≠ L147), N151 (= N215), S152 (≠ N217), R157 (≠ Y222), N185 (≠ S251)
2zsjA Crystal structure of threonine synthase from aquifex aeolicus vf5
37% identity, 79% coverage: 65:393/419 of query aligns to 6:322/350 of 2zsjA
- active site: K61 (= K120), T85 (= T144), Q218 (= Q282), A222 (≠ C286), A240 (≠ S311), T317 (= T388)
- binding pyridoxal-5'-phosphate: F60 (= F119), K61 (= K120), N87 (= N146), V186 (≠ I249), G187 (≠ A250), N188 (≠ S251), A189 (≠ G252), G190 (≠ S253), N191 (≠ Q254), A240 (≠ S311), T317 (= T388), G318 (= G389)
6cgqA Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
35% identity, 80% coverage: 65:399/419 of query aligns to 3:317/339 of 6cgqA
- active site: K56 (= K120), T80 (= T144), E206 (≠ Q282), S210 (≠ C286), A228 (≠ S311), T305 (= T388)
- binding pyridoxal-5'-phosphate: F55 (= F119), K56 (= K120), N82 (= N146), V175 (≠ I249), G176 (≠ A250), N177 (≠ S251), A178 (≠ G252), G179 (≠ S253), N180 (≠ Q254), A228 (≠ S311), E275 (= E358), T305 (= T388), G306 (= G389)
1uimA Crystal structure of threonine synthase from thermus thermophilus hb8, orthorhombic crystal form (see paper)
36% identity, 79% coverage: 62:393/419 of query aligns to 3:322/350 of 1uimA
- active site: K61 (= K120), T85 (= T144), P212 (= P275), G216 (= G280), Q218 (= Q282), A240 (≠ S311), T317 (= T388)
- binding pyridoxal-5'-phosphate: F60 (= F119), K61 (= K120), N87 (= N146), G187 (≠ A250), N188 (≠ S251), A189 (≠ G252), G190 (≠ S253), N191 (≠ Q254), A240 (≠ S311), E287 (= E358), T317 (= T388), G318 (= G389)
3aexA Catalytic intermediate analogue of threonine synthase from thermus thermophilus hb8 (see paper)
36% identity, 79% coverage: 62:393/419 of query aligns to 3:322/351 of 3aexA
- active site: K61 (= K120), T85 (= T144), P212 (= P275), G216 (= G280), Q218 (= Q282), A240 (≠ S311), T317 (= T388)
- binding (3E)-4-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}-2-oxobut-3-enoic acid: K61 (= K120), S84 (= S143), T85 (= T144), N87 (= N146), T88 (≠ L147), V186 (≠ I249), G187 (≠ A250), N188 (≠ S251), A189 (≠ G252), G190 (≠ S253), N191 (≠ Q254), A240 (≠ S311), I241 (≠ L312), E287 (= E358), T317 (= T388)
- binding phosphate ion: K61 (= K120), T88 (≠ L147), N154 (= N217), S155 (vs. gap), R160 (≠ Y222), N188 (≠ S251)
1v7cA Crystal structure of threonine synthase from thermus thermophilus hb8 in complex with a substrate analogue (see paper)
36% identity, 79% coverage: 62:393/419 of query aligns to 3:322/351 of 1v7cA
- active site: K61 (= K120), T85 (= T144), P212 (= P275), G216 (= G280), Q218 (= Q282), A240 (≠ S311), T317 (= T388)
- binding (2e)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]-5-phosphonopent-2-enoic acid: K61 (= K120), S84 (= S143), T85 (= T144), N87 (= N146), T88 (≠ L147), F134 (≠ Y192), N154 (= N217), S155 (vs. gap), R160 (≠ Y222), V186 (≠ I249), G187 (≠ A250), N188 (≠ S251), A189 (≠ G252), G190 (≠ S253), N191 (≠ Q254), A240 (≠ S311), I241 (≠ L312), E287 (= E358), T317 (= T388)
3aeyA Apo form of threonine synthase from thermus thermophilus hb8 (see paper)
36% identity, 79% coverage: 62:393/419 of query aligns to 2:321/350 of 3aeyA
- active site: K60 (= K120), T84 (= T144), P211 (= P275), G215 (= G280), Q217 (= Q282), A239 (≠ S311), T316 (= T388)
- binding sulfate ion: K60 (= K120), K60 (= K120), G85 (= G145), N86 (= N146), T87 (≠ L147), T87 (≠ L147), S154 (vs. gap), R159 (≠ Y222), N187 (≠ S251), R228 (≠ Q301), V230 (= V303), E231 (vs. gap), R232 (≠ K304), A239 (≠ S311)
A0R220 Threonine synthase; TS; EC 4.2.3.1 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
35% identity, 79% coverage: 62:393/419 of query aligns to 13:331/360 of A0R220
- K151 (≠ E201) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
2d1fA Structure of mycobacterium tuberculosis threonine synthase (see paper)
35% identity, 79% coverage: 62:393/419 of query aligns to 4:322/349 of 2d1fA
- active site: K60 (= K120), T84 (= T144), D209 (≠ Q272), R213 (= R277), L215 (≠ F279), A240 (≠ S311), T317 (= T388)
- binding pyridoxal-5'-phosphate: F59 (= F119), K60 (= K120), N86 (= N146), V186 (≠ I249), G187 (≠ A250), N188 (≠ S251), A189 (≠ G252), G190 (≠ S253), N191 (≠ Q254), A240 (≠ S311), T317 (= T388)
P9WG59 Threonine synthase; TS; EC 4.2.3.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
35% identity, 79% coverage: 62:393/419 of query aligns to 13:331/360 of P9WG59
- K69 (= K120) modified: N6-(pyridoxal phosphate)lysine
- N95 (= N146) binding
- K151 (≠ D205) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
- GNAGN 196:200 (≠ ASGSQ 250:254) binding
- T326 (= T388) binding
Q9S7B5 Threonine synthase 1, chloroplastic; Protein METHIONINE OVER-ACCUMULATOR 2; EC 4.2.3.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
30% identity, 73% coverage: 87:393/419 of query aligns to 169:477/526 of Q9S7B5
- N172 (≠ P90) binding
- L173 (= L91) binding
- K181 (≠ A99) binding in monomer B; binding in monomer A
- N187 (≠ D104) binding in monomer B
- L205 (≠ R122) mutation to R: In mto2-1; causes a strong decrease in the concentration of soluble threonine and over-accumulation of methionine.
2c2bA Crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine (see paper)
30% identity, 73% coverage: 87:393/419 of query aligns to 94:402/444 of 2c2bA
- binding pyridoxal-5'-phosphate: F127 (= F119), K128 (= K120), D159 (≠ N146), G259 (≠ I249), G260 (≠ A250), N261 (≠ S251), L262 (≠ G252), G263 (≠ S253), N264 (≠ Q254), A321 (≠ S311), H369 (≠ A360), T397 (= T388)
- binding s-adenosylmethionine: N97 (≠ P90), L98 (= L91), W100 (≠ R93), W115 (≠ H107), W115 (≠ H107), Q246 (= Q236), F247 (≠ L237)
Sites not aligning to the query:
2c2gA Crystal structure of threonine synthase from arabidopsis thaliana in complex with its cofactor pyridoxal phosphate (see paper)
29% identity, 73% coverage: 87:393/419 of query aligns to 112:404/448 of 2c2gA
1pwhA Rat liver l-serine dehydratase- complex with pyridoxyl-(o-methyl- serine)-5-monophosphate (see paper)
27% identity, 72% coverage: 89:389/419 of query aligns to 11:304/327 of 1pwhA
- active site: K41 (= K120), A65 (≠ T144), E194 (≠ Q282), A198 (≠ C286), S200 (≠ P288), A222 (≠ S311), A269 (= A360), C303 (≠ T388)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-o-methyl-l-serine: F40 (= F119), K41 (= K120), S64 (= S143), A65 (≠ T144), N67 (= N146), A68 (≠ L147), F136 (≠ N217), G168 (≠ A250), G169 (≠ S251), G170 (= G252), G171 (≠ S253), A222 (≠ S311), G224 (≠ A313), C303 (≠ T388), G304 (= G389)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
23% identity, 68% coverage: 88:372/419 of query aligns to 31:300/514 of P04968
- K62 (= K120) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N146) binding
- GGGGL 188:192 (≠ ASGSQ 250:254) binding
Sites not aligning to the query:
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
23% identity, 68% coverage: 88:372/419 of query aligns to 27:296/494 of 1tdjA
- active site: K58 (= K120), A83 (≠ T144), E209 (≠ Q282), S213 (≠ C286), C215 (≠ P288), G237 (≠ S311)
- binding pyridoxal-5'-phosphate: F57 (= F119), K58 (= K120), N85 (= N146), G184 (≠ A250), G185 (≠ S251), G186 (= G252), G187 (≠ S253), G237 (≠ S311), E282 (= E358)
Sites not aligning to the query:
Q8VBT2 L-serine dehydratase/L-threonine deaminase; SDH; L-serine deaminase; L-threonine dehydratase; TDH; EC 4.3.1.17; EC 4.3.1.19 from Mus musculus (Mouse)
27% identity, 72% coverage: 89:389/419 of query aligns to 11:304/327 of Q8VBT2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
4d9mA Crystal structure of diaminopropionate ammonia lyase from escherichia coli in complex with aminoacrylate-plp azomethine reaction intermediate (see paper)
28% identity, 36% coverage: 89:237/419 of query aligns to 44:206/378 of 4d9mA
Sites not aligning to the query:
P20132 L-serine dehydratase/L-threonine deaminase; SDH; L-serine deaminase; L-threonine dehydratase; TDH; EC 4.3.1.17; EC 4.3.1.19 from Homo sapiens (Human) (see paper)
27% identity, 71% coverage: 92:389/419 of query aligns to 13:304/328 of P20132
- C303 (≠ T388) mutation to A: Loss of enzyme activity.
Query Sequence
>WP_017599310.1 NCBI__GCF_000341125.1:WP_017599310.1
MAIAATEPTSVRSFGPATALSCRECGERYDLTPRFACEFCFGPLEVAYDFGAVTRADIES
GPNNIWRYRSLLPVPTNVAELPNMNPGLTPLVRADRLAAELGLDSLHVKDDSGNPTHSFK
DRVVAIAVEAARTFGFTTLSCSSTGNLAGAVGAAAARAGFESCVFIPAGLEEGKVVMAAV
YGGKVVAIDGNYDDVNRFCSELIGDPAGEGWGFVNVNLRPYYGEGSKTLAYEIAEQLGWR
LPEQIVIPIASGSQLTKIDKGFQELIKLGLVQDRPYRIFGAQATGCSPVAKAWEAGHDVI
QPVKPDTIAKSLAIGNPADGPYVLDIAQRTGGSVEHVSDAEVVDSINLLARTEGIFAETA
GGVTTGVLRKLVREGRLDPKAETVVLNTGDGLKTLNAVDAGVTATIAPSLSAFAEAGLL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory