SitesBLAST
Comparing WP_017601880.1 NCBI__GCF_000341125.1:WP_017601880.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9X5C9 Quinate/shikimate dehydrogenase (NAD(+)); QSDH; EC 1.1.1.-; EC 1.1.1.24 from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
47% identity, 95% coverage: 14:294/296 of query aligns to 2:283/283 of Q9X5C9
- S17 (= S29) binding
- SRT 17:19 (≠ SLT 29:31) binding
- T69 (= T81) binding ; binding
- K73 (= K85) active site, Proton acceptor; binding ; binding
- N94 (= N106) binding ; binding
- D110 (= D121) binding ; binding
- GV 137:138 (≠ GA 148:149) binding
- D158 (= D169) binding
- R163 (= R174) binding
- PMGM 203:206 (≠ PIGM 214:217) binding
- A213 (≠ P224) binding
- V228 (≠ I239) binding
- G251 (= G262) binding
- Q258 (= Q269) binding ; binding
3jyqA Quinate dehydrogenase from corynebacterium glutamicum in complex with shikimate and nadh (see paper)
47% identity, 95% coverage: 14:294/296 of query aligns to 1:282/282 of 3jyqA
- binding nicotinamide-adenine-dinucleotide: V132 (≠ L144), G135 (= G147), G136 (= G148), V137 (≠ A149), D157 (= D169), L158 (≠ T170), R162 (= R174), T201 (= T213), P202 (= P214), M205 (= M217), V227 (≠ I239), A254 (= A266)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S16 (= S29), N66 (= N79), T68 (= T81), N93 (= N106), D109 (= D121), Q257 (= Q269)
3jypA Quinate dehydrogenase from corynebacterium glutamicum in complex with quinate and nadh (see paper)
47% identity, 95% coverage: 14:294/296 of query aligns to 1:282/282 of 3jypA
- binding nicotinamide-adenine-dinucleotide: V132 (≠ L144), G135 (= G147), V137 (≠ A149), D157 (= D169), L158 (≠ T170), R162 (= R174), T201 (= T213), P202 (= P214), M205 (= M217), A212 (≠ P224), V227 (≠ I239), Y229 (= Y241), A254 (= A266)
- binding (1S,3R,4S,5R)-1,3,4,5-tetrahydroxycyclohexanecarboxylic acid: S16 (= S29), T18 (= T31), N66 (= N79), T68 (= T81), K72 (= K85), N93 (= N106), D109 (= D121), Q257 (= Q269)
3jyoA Quinate dehydrogenase from corynebacterium glutamicum in complex with NAD (see paper)
47% identity, 95% coverage: 14:294/296 of query aligns to 1:282/282 of 3jyoA
- binding nicotinamide-adenine-dinucleotide: V132 (≠ L144), G135 (= G147), V137 (≠ A149), D157 (= D169), L158 (≠ T170), R162 (= R174), T201 (= T213), P202 (= P214), M205 (= M217), V227 (≠ I239), Y229 (= Y241), A254 (= A266)
3tnlA 1.45 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with shikimate and NAD.
34% identity, 89% coverage: 18:281/296 of query aligns to 12:277/288 of 3tnlA
- binding nicotinamide-adenine-dinucleotide: M71 (≠ H82), G134 (= G145), A135 (= A146), G136 (= G147), G137 (= G148), A138 (= A149), N158 (≠ D169), R159 (≠ T170), D161 (≠ V172), F163 (vs. gap), T207 (= T213), V209 (≠ I215), M211 (= M217), F214 (≠ H220), V235 (≠ I239), Y237 (= Y241), M261 (= M265), M262 (≠ A266)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (= S29), S25 (≠ T31), N68 (= N79), S70 (≠ T81), K74 (= K85), N95 (= N106), D110 (= D121), Q265 (= Q269)
3tozA 2.2 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with NAD.
34% identity, 89% coverage: 18:281/296 of query aligns to 15:280/291 of 3tozA
- binding nicotinamide-adenine-dinucleotide: G137 (= G145), A138 (= A146), G139 (= G147), G140 (= G148), A141 (= A149), N161 (≠ D169), R162 (≠ T170), D164 (≠ V172), F166 (vs. gap), T210 (= T213), G211 (≠ P214), V212 (≠ I215), M214 (= M217), F217 (≠ H220), V238 (≠ I239), Y240 (= Y241), G261 (= G262), M264 (= M265), M265 (≠ A266)
Q8Y9N5 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
34% identity, 89% coverage: 18:281/296 of query aligns to 15:280/291 of Q8Y9N5
Q5HNV1 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Staphylococcus epidermidis (strain ATCC 35984 / RP62A) (see paper)
29% identity, 90% coverage: 21:287/296 of query aligns to 5:257/269 of Q5HNV1
- SLS 13:15 (≠ SLT 29:31) binding
- T60 (= T81) binding
- N85 (= N106) binding
- D100 (= D121) binding
- Y211 (= Y241) Plays a major role in the catalytic process and a minor role in the substrate binding; mutation to F: Leads to a 345-fold decrease in the catalytic efficiency and a 3-fold decrease in the affinity binding for shikimate.
- Q239 (= Q269) binding
2hk9B Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
30% identity, 90% coverage: 15:281/296 of query aligns to 5:254/267 of 2hk9B
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V67 (≠ H82), G130 (= G145), G133 (= G148), A134 (= A149), N153 (≠ E173), R154 (= R174), T155 (≠ A175), K158 (≠ L178), T188 (= T213), S189 (≠ P214), V190 (≠ I215), I214 (= I239), M238 (= M265), L239 (≠ A266)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S19 (= S29), S21 (≠ T31), N64 (= N79), T66 (= T81), K70 (= K85), N91 (= N106), D106 (= D121), Y216 (= Y241), L239 (≠ A266), Q242 (= Q269)
2hk9A Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
30% identity, 90% coverage: 15:281/296 of query aligns to 5:254/269 of 2hk9A
- binding 2'-monophosphoadenosine-5'-diphosphate: V67 (≠ H82), G132 (= G147), G133 (= G148), A134 (= A149), N153 (≠ E173), R154 (= R174), T155 (≠ A175), T188 (= T213), S189 (≠ P214), V190 (≠ I215)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S19 (= S29), S21 (≠ T31), N64 (= N79), K70 (= K85), N91 (= N106), D106 (= D121), Y216 (= Y241), L239 (≠ A266), Q242 (= Q269)
O67049 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Aquifex aeolicus (strain VF5) (see paper)
30% identity, 90% coverage: 15:281/296 of query aligns to 5:254/269 of O67049
Q58484 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
33% identity, 92% coverage: 15:287/296 of query aligns to 5:272/282 of Q58484
1nvtB Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
33% identity, 92% coverage: 15:287/296 of query aligns to 10:277/287 of 1nvtB
- active site: K75 (= K85), D111 (= D121)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I72 (≠ H82), G135 (= G145), G137 (= G147), G138 (= G148), A139 (= A149), N157 (≠ D169), R158 (≠ T170), T159 (≠ R171), K162 (≠ R174), A200 (= A212), T201 (= T213), P202 (= P214), I203 (= I215), M205 (= M217), L229 (≠ I239), Y231 (= Y241), M255 (= M265), L256 (≠ A266)
- binding zinc ion: E22 (≠ G27), H23 (≠ P28)
1nvtA Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
33% identity, 92% coverage: 15:287/296 of query aligns to 10:277/287 of 1nvtA
- active site: K75 (= K85), D111 (= D121)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G135 (= G145), A139 (= A149), N157 (≠ D169), R158 (≠ T170), T159 (≠ R171), K162 (≠ R174), A200 (= A212), T201 (= T213), P202 (= P214), I203 (= I215), M205 (= M217), L229 (≠ I239), Y231 (= Y241), G252 (= G262), M255 (= M265), L256 (≠ A266)
3dooA Crystal structure of shikimate dehydrogenase from staphylococcus epidermidis complexed with shikimate (see paper)
28% identity, 90% coverage: 21:287/296 of query aligns to 5:248/258 of 3dooA
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S13 (= S29), S15 (≠ T31), N58 (= N79), T60 (= T81), K64 (= K85), N85 (= N106), D100 (= D121), F227 (≠ A266), Q230 (= Q269)
1npdB X-ray structure of shikimate dehydrogenase complexed with NAD+ from e.Coli (ydib) northeast structural genomics research consortium (nesg) target er24 (see paper)
31% identity, 90% coverage: 15:279/296 of query aligns to 6:272/288 of 1npdB
- binding nicotinamide-adenine-dinucleotide: A132 (= A146), G133 (= G147), G134 (= G148), A135 (= A149), N155 (≠ D169), R156 (≠ T170), D158 (≠ V172), F160 (vs. gap), T204 (= T213), K205 (≠ P214), V206 (≠ I215), M208 (= M217), C232 (≠ I239), M258 (= M265), L259 (≠ A266)
P0A6D5 Quinate/shikimate dehydrogenase; NAD-dependent shikimate 5-dehydrogenase; EC 1.1.1.282 from Escherichia coli (strain K12) (see 4 papers)
31% identity, 90% coverage: 15:279/296 of query aligns to 6:272/288 of P0A6D5
- S22 (≠ T31) mutation to A: Kinetically unchanged as compared with the wild-type.
- Y39 (≠ L46) mutation to F: Kinetically unchanged as compared with the wild-type.
- S67 (≠ T81) mutation to A: Reduces activity towards quinate about 6-fold, but has a little effect on shikimate conversion.
- K71 (= K85) mutation to A: 3200-fold decrease in the affinity for quinate. 170-fold decrease in the affinity for shikimate.; mutation to G: 10-fold greater reduction in catalytic efficiency is observed with quinate than with shikimate.
- N92 (= N106) mutation to A: Alters protein structure. Loss of activity for both substrates.
- T106 (= T120) mutation to A: 2000-fold decrease in the affinity for quinate. 70-fold decrease in the affinity for shikimate. 10-fold greater reduction in catalytic efficiency is observed with quinate than with shikimate.
- D107 (= D121) mutation to A: Loss of activity towards quinate. 20000-fold decrease in the affinity for shikimate.
- AGGA 132:135 (= AGGA 146:149) binding
- NRRD 155:158 (≠ DTRV 169:172) binding
- K205 (≠ P214) binding
- CVYN 232:235 (≠ IVYR 239:242) binding
- G255 (= G262) binding
- Q262 (= Q269) mutation to A: 3-fold reduction in catalytic efficiency for both substrates.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1o9bA Quinate/shikimate dehydrogenase ydib complexed with nadh (see paper)
32% identity, 89% coverage: 18:279/296 of query aligns to 3:266/280 of 1o9bA
- binding 1,4-dihydronicotinamide adenine dinucleotide: A126 (= A146), G127 (= G147), G128 (= G148), A129 (= A149), R150 (≠ T170), F154 (vs. gap), K199 (≠ P214), V200 (≠ I215), M202 (= M217), C226 (≠ I239), Y228 (= Y241), M252 (= M265), L253 (≠ A266)
Q8ZPR4 Quinate/shikimate dehydrogenase; NAD-dependent shikimate 5-dehydrogenase; EC 1.1.1.282 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
32% identity, 89% coverage: 18:279/296 of query aligns to 9:272/288 of Q8ZPR4
P15770 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Escherichia coli (strain K12) (see paper)
33% identity, 92% coverage: 21:292/296 of query aligns to 6:267/272 of P15770
Query Sequence
>WP_017601880.1 NCBI__GCF_000341125.1:WP_017601880.1
MTATTRAPAVSTAHRSYLVGLIGTGIGPSLTPSMHEREAAELHHRLVYRTVDLAELGLAP
DSVVDLVRAARQLGFDGLNVTHPCKQLVLPGLDRLTPDAAALGAVNTVVFESGRTVGHNT
DWSAFARCLERGLPDVPRDRVVVLGAGGAGAAVVHALLGSGVREVTVVDTRVERARELVE
RLSGHHPGAVCRAAGTDALEPLLSRADGMVNATPIGMARHPGTPVPADLLRPSLWVADIV
YRPLRTELLALAEDRGCPTVGGGEMAVFQASQAFGLFTGLEPDTERMLAHFHGLIA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory