Comparing WP_017620408.1 NCBI__GCF_002263495.1:WP_017620408.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
31% identity, 69% coverage: 96:303/303 of query aligns to 74:281/281 of P94530
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
29% identity, 70% coverage: 93:303/303 of query aligns to 79:296/296 of P68183
>WP_017620408.1 NCBI__GCF_002263495.1:WP_017620408.1
MTGTRTDPGTPSSSSPPAPRPARPVAKRRVGRRTRTVLRYALLLLIMAISVGPFLWQLST
ALKGIGEDIYASPPRFVPADPTLGNFVRVGEVLPVWGYVWNSVRVALATVVLNVVGASLA
GYALARLRFRGRRAALGVFILALLVPGEAIMVAQFLMMRSVHLNDTLVAVVLPGMVGALN
VLLMYNAFLAQSTQIDEAAMIDGANAWQRFTRVALPSVKGTIAVVAIFAFMGAWDDFLWP
LIVLSDPDYYTLTIGLNYLKGTFVGDQRLIAAGTIIAVAPLILLFLTLQRYFFRGVNEGA
IKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory