Comparing WP_017752453.1 NCBI__GCF_000816635.1:WP_017752453.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ph4A Clostridium thermocellum ribose-5-phosphate isomerase b with d-allose (see paper)
46% identity, 97% coverage: 1:147/152 of query aligns to 1:147/148 of 3ph4A
3ph3A Clostridium thermocellum ribose-5-phosphate isomerase b with d-ribose (see paper)
46% identity, 97% coverage: 1:147/152 of query aligns to 1:147/148 of 3ph3A
3heeA Structural study of clostridium thermocellum ribose-5-phosphate isomerase b and ribose-5-phosphate (see paper)
46% identity, 97% coverage: 1:147/152 of query aligns to 1:147/148 of 3heeA
P37351 Ribose-5-phosphate isomerase B; Phosphoriboisomerase B; EC 5.3.1.6 from Escherichia coli (strain K12) (see paper)
40% identity, 95% coverage: 2:146/152 of query aligns to 3:147/149 of P37351
P0CL19 Putative ribose 5-phosphate isomerase; EC 5.3.1.- from Coccidioides immitis (strain RS) (Valley fever fungus) (see paper)
39% identity, 97% coverage: 1:147/152 of query aligns to 9:159/163 of P0CL19
3sgwA Crystal structure of ribose-5-phosphate isomerase b rpib from coccidioides immitis semi-covalently bound to malonic acid (see paper)
39% identity, 97% coverage: 1:147/152 of query aligns to 4:154/158 of 3sgwA
3k8cA Complex of trypanosoma cruzi ribose 5-phosphate isomerase type b with 4-deoxy-4-phospho-d-erythronohydroxamic acid (see paper)
35% identity, 95% coverage: 2:146/152 of query aligns to 4:151/152 of 3k8cA
3k7sA Complex of trypanosoma cruzi ribose 5-phosphate isomerase type b with ribose 5-phosphate (see paper)
35% identity, 95% coverage: 2:146/152 of query aligns to 4:151/152 of 3k7sA
3k7pA Structure of mutant of ribose 5-phosphate isomerase type b from trypanosoma cruzi. (see paper)
34% identity, 95% coverage: 2:146/152 of query aligns to 4:151/153 of 3k7pA
4lfnB Crystal structure of d-galactose-6-phosphate isomerase in complex with d-ribulose (see paper)
34% identity, 95% coverage: 1:144/152 of query aligns to 1:142/172 of 4lfnB
4lfmB Crystal structure of d-galactose-6-phosphate isomerase in complex with d-psicose (see paper)
34% identity, 95% coverage: 1:144/152 of query aligns to 1:142/172 of 4lfmB
4lflB Crystal structure of d-galactose-6-phosphate isomerase in complex with d-tagatose-6-phosphate (see paper)
34% identity, 95% coverage: 1:144/152 of query aligns to 1:142/172 of 4lflB
6mu0A Crystal structure of ribose-5-phosphate isomerase b from mycoplasma genitalium with bound ribulose-5-phosphate
33% identity, 91% coverage: 3:140/152 of query aligns to 6:145/152 of 6mu0A
4lfnA Crystal structure of d-galactose-6-phosphate isomerase in complex with d-ribulose (see paper)
25% identity, 94% coverage: 1:143/152 of query aligns to 1:141/142 of 4lfnA
4lfmA Crystal structure of d-galactose-6-phosphate isomerase in complex with d-psicose (see paper)
25% identity, 94% coverage: 1:143/152 of query aligns to 1:141/142 of 4lfmA
4lflA Crystal structure of d-galactose-6-phosphate isomerase in complex with d-tagatose-6-phosphate (see paper)
25% identity, 94% coverage: 1:143/152 of query aligns to 1:141/142 of 4lflA
2vvpA Crystal structure of mycobacterium tuberculosis ribose-5-phosphate isomerase b in complex with its substrates ribose 5-phosphate and ribulose 5-phosphate (see paper)
26% identity, 97% coverage: 1:147/152 of query aligns to 2:150/157 of 2vvpA
2betA Structure of mycobacterium tuberculosis ribose-5-phosphate isomerase, rpib, rv2465c, in complex with 4-phospho-d-erythronate. (see paper)
26% identity, 97% coverage: 1:147/152 of query aligns to 2:150/157 of 2betA
2besC Structure of mycobacterium tuberculosis ribose-5-phosphate isomerase, rpib, rv2465c, in complex with 4-phospho-d-erythronohydroxamic acid. (see paper)
26% identity, 97% coverage: 1:147/152 of query aligns to 2:150/158 of 2besC
2vvqA Crystal structure of mycobacterium tuberculosis ribose-5-phosphate isomerase b in complex with the inhibitor 5-deoxy-5-phospho-d- ribonate (see paper)
26% identity, 97% coverage: 1:147/152 of query aligns to 2:150/156 of 2vvqA
>WP_017752453.1 NCBI__GCF_000816635.1:WP_017752453.1
MKIAIGCDQNGYALKSQLIKFLQEKNIKYVDFGSNEGESVYYPNIALKVGKEIASGNFDR
GILICGTGIGMAITANKVPGVRAAVCHDIYSAERAQKSNNAQIATFGAEIVGPSLAKYLL
DIWLNSKFVDGRSTPKVKLINEIDKNFRKEIS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory