SitesBLAST
Comparing WP_018123527.1 NCBI__GCF_000375485.1:WP_018123527.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
P0AEY3 Nucleoside triphosphate pyrophosphohydrolase; NTP-PPase; EC 3.6.1.8 from Escherichia coli (strain K12) (see paper)
34% identity, 94% coverage: 16:266/266 of query aligns to 7:260/263 of P0AEY3
- R95 (= R103) mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- K119 (= K127) mutation to A: Does not affect the nucleotide pyrophosphohydrolysis activity.
- K168 (≠ E172) mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- KVYEE 168:172 (≠ EVQRQ 172:176) binding ATP
- E171 (≠ R175) mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- E172 (≠ Q176) mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- E175 (≠ S179) binding ATP; mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- K189 (≠ A195) mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- KLEE 189:192 (≠ ASEK 195:198) binding ATP
- E192 (≠ K198) mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- E193 (= E199) mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- D196 (= D202) binding ATP; mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- K222 (= K228) mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- KFERR 222:226 (≠ KFLRR 228:232) binding ATP
- R226 (= R232) mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- W253 (= W259) binding ATP; mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- K257 (= K263) mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
Q9X015 Nucleoside triphosphate pyrophosphohydrolase/pyrophosphatase MazG; NTP-PPase; EC 3.6.1.1; EC 3.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
38% identity, 94% coverage: 15:263/266 of query aligns to 10:250/255 of Q9X015
- E41 (= E46) mutation to Q: Reduces the NTPase activity to 10% of the wild-type activity; when associated with Q-42.
- E42 (= E47) mutation to Q: Reduces the NTPase activity to 10% of the wild-type activity; when associated with Q-41.
- E45 (= E50) mutation to Q: Reduces the NTPase activity to 10% of the wild-type activity.
- E61 (= E66) mutation to Q: Reduces the NTPase activity to 10% of the wild-type activity.
- R97 (= R102) mutation to A: Reduces the NTPase activity to 10% of the wild-type activity; when associated with A-98.
- R98 (= R103) mutation to A: Reduces the NTPase activity to 10% of the wild-type activity; when associated with A-97.
- K118 (= K127) mutation to E: Reduces the NTPase activity to 10% of the wild-type activity.
- E173 (≠ Q186) mutation to A: Has little effects on the NTPase activity.
- E176 (= E189) mutation to A: Has little effects on the NTPase activity.
- EE 185:186 (≠ KE 198:199) mutation to AA: Has little effects on the NTPase activity.
3crcA Crystal structure of escherichia coli mazg, the regulator of nutritional stress response (see paper)
32% identity, 94% coverage: 16:266/266 of query aligns to 6:225/225 of 3crcA
3crcB Crystal structure of escherichia coli mazg, the regulator of nutritional stress response (see paper)
29% identity, 89% coverage: 31:266/266 of query aligns to 14:219/220 of 3crcB
A0R3C4 Nucleoside triphosphate pyrophosphohydrolase; NTP-PPase; EC 3.6.1.8 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
34% identity, 51% coverage: 30:165/266 of query aligns to 102:238/324 of A0R3C4
- A222 (≠ P149) mutation to E: Pyrophosphohydrolase activity is reduced 30-fold.
P96379 Nucleoside triphosphate pyrophosphohydrolase; NTP-PPase; EC 3.6.1.8 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 51% coverage: 30:165/266 of query aligns to 102:235/325 of P96379
- A219 (≠ P149) mutation to E: Pyrophosphohydrolase activity is reduced 20-fold. It affects the magnesium binding and the protein structure.
7yh5B Mazg(mycobacterium tuberculosis) (see paper)
38% identity, 24% coverage: 30:92/266 of query aligns to 102:166/177 of 7yh5B
2yxhA Crystal structure of mazg-related protein from thermotoga maritima
24% identity, 35% coverage: 29:120/266 of query aligns to 16:109/114 of 2yxhA
Query Sequence
>WP_018123527.1 NCBI__GCF_000375485.1:WP_018123527.1
MSERTFDDGAEALAELRDVLNSLLGPEGCPWDKDQTPASLCDYLAEETFELIEGIRAGDT
RETMEEMGDVLFILLFMNTLHEQSGDFSMSDALRHSAAKMIRRHPHVFGKKRFDTQEQLW
DNWEKTKKQEKESEGSKGVFDSLPKGLPPLLRSYRINSKAARNGFTWDSDEEVQRQYESE
WTEWQQALEAGDTDASEKEFGDLLFTLVELGRRKGIKANAALDFANQKFLRRFAQMEKMA
EERGQSLDDMDLDAMNQLWDEAKQSE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory