SitesBLAST
Comparing WP_018125210.1 NCBI__GCF_000375485.1:WP_018125210.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1vpeA Crystallographic analysis of phosphoglycerate kinase from the hyperthermophilic bacterium thermotoga maritima (see paper)
51% identity, 98% coverage: 4:395/400 of query aligns to 5:394/398 of 1vpeA
- active site: R35 (= R34), K196 (= K200), G353 (= G354), G376 (= G377)
- binding phosphoaminophosphonic acid-adenylate ester: G194 (= G198), A195 (= A199), K196 (= K200), K200 (= K204), G218 (= G222), A219 (= A223), N316 (= N319), P318 (= P321), G320 (= G323), V321 (≠ L324), E323 (= E326), G352 (= G353), G353 (= G354), D354 (= D355), S355 (≠ T356)
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
51% identity, 98% coverage: 4:394/400 of query aligns to 6:394/654 of P36204
- R36 (= R34) binding
- R118 (= R116) binding
- R151 (= R153) binding
1phpA Structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms (see paper)
49% identity, 99% coverage: 2:396/400 of query aligns to 4:393/394 of 1phpA
- active site: R36 (= R34), K197 (= K200), G351 (= G354), G374 (= G377)
- binding adenosine-5'-diphosphate: G195 (= G198), K201 (= K204), G219 (= G222), G220 (≠ A223), L237 (= L240), N316 (= N319), P318 (= P321), G320 (= G323), V321 (≠ L324), E323 (= E326), G350 (= G353), D352 (= D355), S353 (≠ T356)
P18912 Phosphoglycerate kinase; EC 2.7.2.3 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
49% identity, 99% coverage: 2:396/400 of query aligns to 4:393/394 of P18912
P40924 Phosphoglycerate kinase; EC 2.7.2.3 from Bacillus subtilis (strain 168) (see paper)
45% identity, 99% coverage: 2:396/400 of query aligns to 4:393/394 of P40924
- S183 (≠ A186) modified: Phosphoserine
- T299 (≠ S302) modified: Phosphothreonine
1ltkC Crystal structure of phosphoglycerate kinase from plasmodium falciparum, in the open conformation
46% identity, 98% coverage: 5:394/400 of query aligns to 18:421/424 of 1ltkC
- active site: R47 (= R34), K223 (= K200), G381 (= G354), G404 (= G377)
- binding adenosine monophosphate: G221 (= G198), A222 (= A199), K223 (= K200), G245 (= G222), G246 (≠ A223), G348 (= G323), V349 (≠ L324), E351 (= E326), D382 (= D355)
P00560 Phosphoglycerate kinase; EC 2.7.2.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
45% identity, 98% coverage: 4:396/400 of query aligns to 9:414/416 of P00560
- R22 (= R17) mutation to K: 2-fold reduction of Vmax.; mutation to M: 7-fold reduction of Vmax.
- R39 (= R34) binding
- R122 (= R116) binding
- R169 (= R153) binding
1qpgA 3-phosphoglycerate kinase, mutation r65q (see paper)
45% identity, 98% coverage: 4:396/400 of query aligns to 8:413/415 of 1qpgA
- active site: R38 (= R34), K213 (= K200), G371 (= G354), G394 (= G377)
- binding magnesium-5'-adenyly-imido-triphosphate: G235 (= G222), G236 (≠ A223), N334 (= N319), P336 (= P321), G338 (= G323), V339 (≠ L324), F340 (= F325), E341 (= E326), G370 (= G353), G371 (= G354), D372 (= D355), T373 (= T356)
3pgkA The structure of yeast phosphoglycerate kinase at 0.25 nm resolution (see paper)
45% identity, 98% coverage: 4:396/400 of query aligns to 8:413/415 of 3pgkA
- active site: R38 (= R34), K213 (= K200), G371 (= G354), G394 (= G377)
- binding adenosine-5'-triphosphate: G211 (= G198), A212 (= A199), K213 (= K200), F289 (≠ P275), L311 (= L296), N334 (= N319), G335 (= G320), P336 (= P321), G338 (= G323), V339 (≠ L324), D372 (= D355)
6yjeA Plasmoodium vivax phosphoglycerate kinase bound to nitrofuran inhibitor from peg3350 and ammonium acetate at ph 5.5
44% identity, 99% coverage: 1:394/400 of query aligns to 6:413/416 of 6yjeA
- active site: R39 (= R34), K215 (= K200), G373 (= G354), G396 (= G377)
- binding (2~{S})-2-(5-nitrofuran-2-yl)-2,3,5,6,7,8-hexahydro-1~{H}-[1]benzothiolo[2,3-d]pyrimidin-4-one: G237 (= G222), G238 (≠ A223), Y241 (≠ N226), L256 (= L245), F291 (≠ P275), M311 (= M294), G312 (≠ V295), L313 (= L296), G340 (= G323), V341 (≠ L324)
4ng4B Structure of phosphoglycerate kinase (cbu_1782) from coxiella burnetii (see paper)
43% identity, 98% coverage: 4:396/400 of query aligns to 5:386/389 of 4ng4B
- active site: R35 (= R34), K191 (= K200), G344 (= G354), G367 (= G377)
- binding adenosine-5'-diphosphate: G189 (= G198), K195 (= K204), G213 (= G222), I286 (≠ V295), N310 (= N319), G311 (= G320), P312 (= P321), V315 (≠ L324), E317 (= E326), G343 (= G353), D345 (= D355), T346 (= T356)
- binding magnesium ion: D288 (= D297), G314 (= G323), F321 (= F330), S322 (≠ A331), T325 (≠ S334)
O60101 Phosphoglycerate kinase; EC 2.7.2.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
46% identity, 98% coverage: 4:394/400 of query aligns to 9:411/414 of O60101
- Y75 (≠ L69) modified: Phosphotyrosine
- S76 (≠ T70) modified: Phosphoserine
- S143 (vs. gap) modified: Phosphoserine
- S172 (≠ A156) modified: Phosphoserine
- S173 (= S157) modified: Phosphoserine
- S183 (≠ A165) modified: Phosphoserine
- S253 (= S239) modified: Phosphoserine
- S260 (≠ F246) modified: Phosphoserine
- T299 (≠ G285) modified: Phosphothreonine
- S328 (≠ A313) modified: Phosphoserine
- S351 (≠ E336) modified: Phosphoserine
- T373 (= T356) modified: Phosphothreonine
- S387 (= S370) modified: Phosphoserine
- S390 (= S373) modified: Phosphoserine
Sites not aligning to the query:
- 412 modified: Phosphoserine
- 413 modified: Phosphoserine
16pkA Phosphoglycerate kinase from trypanosoma brucei bisubstrate analog (see paper)
40% identity, 98% coverage: 2:394/400 of query aligns to 3:412/415 of 16pkA
- active site: R35 (= R34), K215 (= K200), G372 (= G354), G395 (= G377)
- binding 1,1,5,5-tetrafluorophosphopentylphosphonic acid adenylate ester: G213 (= G198), A214 (= A199), K219 (= K204), A238 (= A223), Y241 (≠ N226), L311 (= L296), P336 (= P321), G338 (= G323), V339 (≠ L324), E341 (= E326), G393 (= G375), G394 (= G376), G395 (= G377)
13pkA Ternary complex of phosphoglycerate kinase from trypanosoma brucei (see paper)
40% identity, 98% coverage: 2:394/400 of query aligns to 3:412/415 of 13pkA
- active site: R35 (= R34), K215 (= K200), G372 (= G354), G395 (= G377)
- binding adenosine-5'-diphosphate: G213 (= G198), A214 (= A199), K219 (= K204), L311 (= L296), P336 (= P321), G338 (= G323), V339 (≠ L324), E341 (= E326), G371 (= G353), D373 (= D355), S374 (≠ T356)
P07378 Phosphoglycerate kinase, glycosomal; Phosphoglycerate kinase C; EC 2.7.2.3 from Trypanosoma brucei brucei (see 2 papers)
40% identity, 99% coverage: 2:396/400 of query aligns to 7:418/440 of P07378
P09041 Phosphoglycerate kinase 2; Phosphoglycerate kinase, testis specific; EC 2.7.2.3 from Mus musculus (Mouse) (see paper)
43% identity, 98% coverage: 4:394/400 of query aligns to 9:414/417 of P09041
2paaA Crystal structure of phosphoglycerate kinase-2 bound to atp and 3pg (see paper)
43% identity, 98% coverage: 4:394/400 of query aligns to 5:410/413 of 2paaA
- active site: R35 (= R34), K212 (= K200), G370 (= G354), G393 (= G377)
- binding adenosine-5'-triphosphate: G210 (= G198), A211 (= A199), K216 (= K204), G235 (≠ A223), L253 (= L240), G309 (≠ V295), L310 (= L296), G334 (= G320), G337 (= G323), V338 (≠ L324), E340 (= E326), D371 (= D355)
4axxA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp 3-phosphoglycerate and beryllium trifluoride
44% identity, 98% coverage: 4:394/400 of query aligns to 7:404/407 of 4axxA
- active site: R37 (= R34), K206 (= K200), G364 (= G354), G387 (= G377)
- binding adenosine-5'-diphosphate: G204 (= G198), A205 (= A199), K210 (= K204), G228 (= G222), G229 (≠ A223), N327 (= N319), P329 (= P321), G331 (= G323), V332 (≠ L324), E334 (= E326), G363 (= G353), G364 (= G354), D365 (= D355), T366 (= T356)
- binding beryllium trifluoride ion: K206 (= K200), K210 (= K204), G363 (= G353)
P00558 Phosphoglycerate kinase 1; Cell migration-inducing gene 10 protein; Primer recognition protein 2; PRP 2; EC 2.7.2.3 from Homo sapiens (Human) (see 16 papers)
43% identity, 98% coverage: 4:394/400 of query aligns to 9:414/417 of P00558
- DFN 24:26 (= DFN 19:21) binding
- R39 (= R34) binding
- HLGR 63:66 (≠ HLGK 57:60) binding
- L88 (= L81) to P: in PGK1D; with congenital non-spherocytic anemia; variant Matsue; dbSNP:rs137852531
- K97 (≠ P90) modified: N6-(2-hydroxyisobutyryl)lysine; alternate
- R123 (= R116) binding
- K131 (= K124) modified: N6-malonyllysine; alternate
- G158 (≠ A140) to V: in PGK1D; with chronic hemolytic anemia; variant Shizuoka; dbSNP:rs137852532
- D164 (= D146) to V: in PGK1D; with chronic hemolytic anemia and intellectual disability; variant Amiens; dbSNP:rs137852538
- R171 (= R153) binding
- K191 (= K175) natural variant: Missing (in PGK1D; with chronic hemolytic anemia; variant Alabama)
- R206 (= R190) to P: in PGK1D; with chronic hemolytic anemia; variant Uppsala; dbSNP:rs137852529
- K216 (= K200) modified: N6-(2-hydroxyisobutyryl)lysine
- K220 (= K204) binding ; modified: N6-(2-hydroxyisobutyryl)lysine
- E252 (≠ G235) to A: in PGK1D; with chronic hemolytic anemia; variant Antwerp
- V266 (≠ A249) to M: in PGK1D; with chronic non-spherocytic hemolytic anemia; variant Tokyo; dbSNP:rs431905501
- D268 (≠ K251) to N: in Munchen; 21% of activity; dbSNP:rs137852528
- D285 (= D268) to V: in PGK1D; with chronic hemolytic anemia; variant Herlev; 50% of activity; dbSNP:rs137852535
- G313 (≠ V295) binding
- D315 (= D297) to N: in PGK1D; with rhabdomyolysis; variant Creteil
- C316 (≠ I298) to R: in PGK1D; with chronic hemolytic anemia; variant Michigan; dbSNP:rs137852533
- K323 (≠ T305) modified: N6-(2-hydroxyisobutyryl)lysine
- E344 (= E326) binding
- T352 (≠ S334) to N: in dbSNP:rs137852530
- GGDT 373:376 (= GGDT 353:356) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2y3iA The structure of the fully closed conformation of human pgk in complex with l-adp, 3pg and the tsa aluminium tetrafluoride (see paper)
43% identity, 98% coverage: 4:394/400 of query aligns to 7:412/414 of 2y3iA
- active site: R37 (= R34), K214 (= K200), G372 (= G354), G395 (= G377)
- binding tetrafluoroaluminate ion: K214 (= K200), G371 (= G353), G372 (= G354), G394 (= G376)
- binding l-adenosine-5'-diphosphate: G212 (= G198), A213 (= A199), F290 (≠ P275), N335 (= N319), G339 (= G323), V340 (≠ L324), E342 (= E326), G371 (= G353), G372 (= G354), D373 (= D355), T374 (= T356)
Query Sequence
>WP_018125210.1 NCBI__GCF_000375485.1:WP_018125210.1
MQYIDQMDIKGKKLLFRVDFNVPLDGSTITDDNRIRAVVPTLRYAMEQGAAVIVCAHLGK
PKGQVVPELTLAPIAKRLGELLETDVALAPDCVGPDVESMAASLQPGQVMMLENLRFHKE
EQGKTAEDRGDFGKQLASLADIYVNDAFGVAHRANASVVDVPAHAKDCCIGFLMKKEWEY
LGTALADPKRPFVAVSGGAKVSSKLGILYNLLGKVDHIIIGGAMANTFLAAQGHGVGKSL
VENDLFDEALKIMETARQKGSQIHLPQDFVYADSPDADKANGSCGADCIPEDMMVLDIGP
ESIETFKKVLDGAGTVVWNGPMGLFETPAFAEGSMELCKVMADMPEAVTIVGGGDTDAVV
HKAGLTERFSFISTGGGSFLEFLEGKELPAFKALKECFAK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory