Comparing WP_018232206.1 NCBI__GCF_000378965.1:WP_018232206.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
7npjB Crystal structure of mycobacterium tuberculosis argc in complex with 6-phenoxy-3-pyridinamine
41% identity, 99% coverage: 3:343/343 of query aligns to 3:344/344 of 7npjB
7nphC Crystal structure of mycobacterium tuberculosis argc in complex with 5-methoxy-1,3-benzoxazole-2-carboxylic acid
41% identity, 99% coverage: 3:343/343 of query aligns to 3:344/344 of 7nphC
7notA Crystal structure of mycobacterium tuberculosis argc in complex with nicotinamide adenine dinucleotide phosphate (NADP+) and 5-methoxy-3- indoleacetic acid
41% identity, 99% coverage: 3:343/343 of query aligns to 3:344/344 of 7notA
7nnrA Crystal structure of mycobacterium tuberculosis argc in complex with xanthene-9-carboxylic acid
41% identity, 99% coverage: 3:343/343 of query aligns to 3:344/344 of 7nnrA
2i3gA Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (rv1652) from mycobacterium tuberculosis in complex with NADP+. (see paper)
41% identity, 99% coverage: 3:343/343 of query aligns to 6:347/347 of 2i3gA
O50146 [LysW]-L-2-aminoadipate 6-phosphate reductase; EC 1.2.1.103 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
37% identity, 97% coverage: 6:337/343 of query aligns to 8:338/344 of O50146
2ozpA Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (ttha1904) from thermus thermophilus
37% identity, 97% coverage: 6:337/343 of query aligns to 6:336/342 of 2ozpA
5einA Crystal structure of c148a mutant of lysy from thermus thermophilus in complex with NADP+ and lysw-gamma-aminoadipic acid (see paper)
37% identity, 97% coverage: 6:337/343 of query aligns to 8:338/344 of 5einA
4dpmA Structure of malonyl-coenzyme a reductase from crenarchaeota in complex with coa (see paper)
28% identity, 31% coverage: 2:108/343 of query aligns to 3:114/354 of 4dpmA
Sites not aligning to the query:
4dplA Structure of malonyl-coenzyme a reductase from crenarchaeota in complex with NADP (see paper)
28% identity, 31% coverage: 2:108/343 of query aligns to 3:114/354 of 4dplA
Sites not aligning to the query:
4dpkA Structure of malonyl-coenzyme a reductase from crenarchaeota (see paper)
28% identity, 31% coverage: 2:108/343 of query aligns to 3:114/354 of 4dpkA
Sites not aligning to the query:
1ys4A Structure of aspartate-semialdehyde dehydrogenase from methanococcus jannaschii (see paper)
21% identity, 53% coverage: 2:184/343 of query aligns to 3:184/348 of 1ys4A
Sites not aligning to the query:
Q57658 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
21% identity, 53% coverage: 2:184/343 of query aligns to 9:190/354 of Q57658
Sites not aligning to the query:
>WP_018232206.1 NCBI__GCF_000378965.1:WP_018232206.1
MIRAGIVGATGYTGVELLRLLFTHPEVEPVVVTSRGNAGEALDTLFPNLRGHTSLAFTEP
NAGRLSECDVVFFATPHGVAHGLAGELLSRGTRVIDLSADFRLRDPDLWAHWYGQSHGAP
ELLDLAVYGLPEINRAHIPDARLIAVPGCYPTAVILGFVPLLEGGLVDAGRLVADAKSGV
SGAGRKAQVGTLLCEASESFKAYGVAGHRHLPEILQALAEVAGAAPRLTFVPHLVPMIRG
IHATLYATLSDSGADLQAVYEQRYRDEPFVDVMPAGSHPETRSVRGTNRCRVAVHRPGDG
DTVVVLSVIDNLVKGASGQAIQNLNLMFGLAETTGLDGIAVLP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory