Comparing WP_018233371.1 NCBI__GCF_000378965.1:WP_018233371.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
6j2lA Crystal structure of bi-functional enzyme (see paper)
43% identity, 81% coverage: 6:93/109 of query aligns to 113:200/200 of 6j2lA
Sites not aligning to the query:
6j2lB Crystal structure of bi-functional enzyme (see paper)
39% identity, 81% coverage: 6:93/109 of query aligns to 106:185/185 of 6j2lB
Sites not aligning to the query:
>WP_018233371.1 NCBI__GCF_000378965.1:WP_018233371.1
MNSDRILDELARVLESRKQAPPDSSYVAGLYAKGLDAILKKVGEEATETVVAAKNGNREQ
LVHETADLWFHCLVMLAHQGLGPDAVLAELGRRFGVSGIDEKAGRAAQT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory