Comparing WP_019387621.1 NCBI__GCF_000283015.1:WP_019387621.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3c02A X-ray structure of the aquaglyceroporin from plasmodium falciparum (see paper)
35% identity, 93% coverage: 6:231/242 of query aligns to 8:224/242 of 3c02A
8c9hA Aqp7_inhibitor (see paper)
35% identity, 98% coverage: 6:241/242 of query aligns to 14:250/253 of 8c9hA
6n1gA Crystal structure of aquaglyceroporin aqp7 (see paper)
35% identity, 98% coverage: 6:241/242 of query aligns to 8:244/249 of 6n1gA
O14520 Aquaporin-7; AQP-7; Aquaglyceroporin-7; Aquaporin adipose; AQPap; Aquaporin-7-like from Homo sapiens (Human) (see 4 papers)
35% identity, 97% coverage: 6:239/242 of query aligns to 39:273/342 of O14520
Sites not aligning to the query:
I1CR68 Aquaporin-1 from Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar) (see paper)
34% identity, 98% coverage: 6:242/242 of query aligns to 63:300/306 of I1CR68
6f7hC Crystal structure of human aqp10 (see paper)
33% identity, 94% coverage: 6:233/242 of query aligns to 11:240/253 of 6f7hC
Q96PS8 Aquaporin-10; AQP-10; Aquaglyceroporin-10; Small intestine aquaporin from Homo sapiens (Human) (see 2 papers)
33% identity, 94% coverage: 6:233/242 of query aligns to 26:255/301 of Q96PS8
B1VB61 Propanediol uptake facilitator PduF from Citrobacter freundii (see paper)
32% identity, 95% coverage: 6:235/242 of query aligns to 11:246/269 of B1VB61
P37451 Propanediol uptake facilitator PduF from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
31% identity, 95% coverage: 6:235/242 of query aligns to 11:246/264 of P37451
1fx8A Crystal structure of the e. Coli glycerol facilitator (glpf) with substrate glycerol (see paper)
34% identity, 95% coverage: 6:236/242 of query aligns to 8:244/254 of 1fx8A
P0AER0 Glycerol uptake facilitator protein; Aquaglyceroporin; Glycerol facilitator from Escherichia coli (strain K12) (see 3 papers)
34% identity, 95% coverage: 6:236/242 of query aligns to 13:249/281 of P0AER0
8jy8A Structure of tbaqp2 in complex with anti-trypanosomatid drug pentamidine (see paper)
31% identity, 96% coverage: 6:237/242 of query aligns to 6:235/242 of 8jy8A
8jy6A Structure of tbaqp2 in complex with anti-trypanosomatid drug melarsoprol (see paper)
31% identity, 96% coverage: 6:237/242 of query aligns to 6:235/242 of 8jy6A
2evuA Crystal structure of aquaporin aqpm at 2.3a resolution (see paper)
32% identity, 95% coverage: 6:236/242 of query aligns to 10:238/245 of 2evuA
P08995 Nodulin-26; N-26 from Glycine max (Soybean) (Glycine hispida) (see paper)
32% identity, 95% coverage: 1:231/242 of query aligns to 37:237/271 of P08995
Sites not aligning to the query:
Q9SAI4 Aquaporin NIP6-1; NOD26-like intrinsic protein 6-1; AtNIP6;1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 96% coverage: 4:235/242 of query aligns to 82:282/305 of Q9SAI4
Q08733 Aquaporin PIP1-3; AtPIP1;3; Plasma membrane intrinsic protein 1c; PIP1c; Transmembrane protein B; TMP-B from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 80% coverage: 44:236/242 of query aligns to 92:271/286 of Q08733
Sites not aligning to the query:
P43287 Aquaporin PIP2-2; Plasma membrane intrinsic protein 2-2; AtPIP2;2; Plasma membrane intrinsic protein 2b; PIP2b; TMP2b from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
31% identity, 80% coverage: 44:236/242 of query aligns to 83:262/285 of P43287
Sites not aligning to the query:
P61837 Aquaporin PIP1-1; AtPIP1;1; Plasma membrane aquaporin-1; Plasma membrane intrinsic protein 1a; PIP1a from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 80% coverage: 44:236/242 of query aligns to 92:271/286 of P61837
Sites not aligning to the query:
Q06611 Aquaporin PIP1-2; AtPIP1;2; Plasma membrane intrinsic protein 1b; PIP1b; Transmembrane protein A; AthH2; TMP-A from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 80% coverage: 44:236/242 of query aligns to 92:271/286 of Q06611
Sites not aligning to the query:
>WP_019387621.1 NCBI__GCF_000283015.1:WP_019387621.1
MTPLAAEIIGTALLILLGGGVVANVVLNKTIGNNSGWIVITTGWALAVYVAVVVAGPYSG
AHINPAVSISLAIAGKFPWESVPLYVVAQMIGAMLGAFMVWLMYKNHFDATEDGDSKKAV
FCTAPAIRNTFSNFISEAVGTFVLIFTILYFTNATISDSQTIIGLGSLGALPVALLVWSI
GLSLGGTTGYAINPARDLGPRIMHALLPIKNKVSNDWGYAWIPVIAPIVGASLAALLMLA
LS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory