Comparing WP_019555867.1 NCBI__GCF_000381085.1:WP_019555867.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6rl5G The first crystal structure of the daba aminotransferase ectb in the ectoine biosynthesis pathway of the model organism chromohalobacter salexigens dsm 3034 (see paper)
51% identity, 96% coverage: 4:416/428 of query aligns to 3:419/422 of 6rl5G
1sffA Structure of gamma-aminobutyrate aminotransferase complex with aminooxyacetate (see paper)
30% identity, 93% coverage: 14:411/428 of query aligns to 16:419/425 of 1sffA
1sf2A Structure of e. Coli gamma-aminobutyrate aminotransferase (see paper)
30% identity, 93% coverage: 14:411/428 of query aligns to 16:419/425 of 1sf2A
P22256 4-aminobutyrate aminotransferase GabT; 5-aminovalerate transaminase; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT; EC 2.6.1.19; EC 2.6.1.48 from Escherichia coli (strain K12) (see 2 papers)
30% identity, 93% coverage: 14:411/428 of query aligns to 17:420/426 of P22256
1szkA The structure of gamma-aminobutyrate aminotransferase mutant: e211s (see paper)
30% identity, 93% coverage: 14:411/428 of query aligns to 16:419/425 of 1szkA
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
30% identity, 92% coverage: 20:412/428 of query aligns to 10:375/375 of 2eh6A
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
30% identity, 92% coverage: 20:412/428 of query aligns to 11:376/376 of O66442
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
30% identity, 88% coverage: 20:396/428 of query aligns to 10:366/385 of Q9X2A5
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
30% identity, 88% coverage: 20:396/428 of query aligns to 18:374/393 of 2ordA
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
33% identity, 92% coverage: 21:412/428 of query aligns to 18:389/390 of 8ht4B
3nx3A Crystal structure of acetylornithine aminotransferase (argd) from campylobacter jejuni
30% identity, 94% coverage: 10:412/428 of query aligns to 1:385/388 of 3nx3A
P50457 4-aminobutyrate aminotransferase PuuE; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; EC 2.6.1.19 from Escherichia coli (strain K12) (see paper)
32% identity, 91% coverage: 25:412/428 of query aligns to 27:419/421 of P50457
P40732 Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
29% identity, 91% coverage: 26:416/428 of query aligns to 30:404/405 of P40732
4jevB N-acetylornithine aminotransferase from s. Typhimurium complexed with gabaculine
29% identity, 91% coverage: 26:416/428 of query aligns to 25:399/402 of 4jevB
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
33% identity, 87% coverage: 26:399/428 of query aligns to 25:373/387 of 1wkhA
Sites not aligning to the query:
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
33% identity, 87% coverage: 26:399/428 of query aligns to 25:373/387 of 1wkgA
Sites not aligning to the query:
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
33% identity, 87% coverage: 26:399/428 of query aligns to 25:373/387 of 1vefA
Sites not aligning to the query:
O50131 Ornithine aminotransferase; Orn-AT; Ornithine delta-aminotransferase; EC 2.6.1.13 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see paper)
29% identity, 96% coverage: 2:412/428 of query aligns to 18:442/454 of O50131
7vo1A Structure of aminotransferase-substrate complex (see paper)
29% identity, 96% coverage: 2:412/428 of query aligns to 16:440/452 of 7vo1A
7vntA Structure of aminotransferase-substrate complex (see paper)
29% identity, 96% coverage: 2:412/428 of query aligns to 16:440/452 of 7vntA
>WP_019555867.1 NCBI__GCF_000381085.1:WP_019555867.1
MTFEVFNKYESEVRGYIRSFPTIFEKSKMAEIWDVSGKRYIDFFAGAGALNYGHNNPKIN
DAVISYLQNDGIGHALDMGTVAKRDFMESFVNNILKPRDLDYKLQFVGPTGTGAIEAALK
IARKVKGRKQIMSFTNGFHGMSMGSLSITGNKYYHDESYGVPGYTTQVPFHKYLGDKVDT
IAYLRKILEDDSSGTELPAAIVLETVQAEGGINVAGEEWLKDLRQICDDFDILMIVDDIQ
VGNGRSGDFFSFERAGIKPDIITLSKSIGAGHPMALVLLKPELDIWTAGEHSGTFRGNNL
AFVASTVALDTYWSDDSFSKEVKIKAKLVEQRMQKLVSRFPEIINETRGLGMIWGAEFKD
PSITSAICSQAFEDGLVIETAGAESDLIKFLGPLVMTEELINEGFDILENAIVKVLKTYT
PNTTKGAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory