Comparing WP_019556286.1 NCBI__GCF_000381085.1:WP_019556286.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
P0A9J8 Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 from Escherichia coli (strain K12)
30% identity, 99% coverage: 1:359/363 of query aligns to 1:376/386 of P0A9J8
2qmxA The crystal structure of l-phe inhibited prephenate dehydratase from chlorobium tepidum tls (see paper)
31% identity, 73% coverage: 96:360/363 of query aligns to 4:275/278 of 2qmxA
3mwbA The crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a
33% identity, 73% coverage: 95:358/363 of query aligns to 2:274/306 of 3mwbA
3mwbB The crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a
34% identity, 73% coverage: 95:358/363 of query aligns to 2:271/303 of 3mwbB
6vh5D Crystal structure of prephenate dehydratase from brucella melitensis biovar abortus 2308 in complex with phenylalanine
30% identity, 72% coverage: 96:358/363 of query aligns to 9:276/282 of 6vh5D
7am0B Gqqa- a novel type of quorum quenching acylases (see paper)
29% identity, 74% coverage: 96:363/363 of query aligns to 4:274/278 of 7am0B
3luyA Putative chorismate mutase from bifidobacterium adolescentis
24% identity, 72% coverage: 98:359/363 of query aligns to 8:284/326 of 3luyA
7alzA Gqqa- a novel type of quorum quenching acylases (see paper)
31% identity, 32% coverage: 248:363/363 of query aligns to 73:190/194 of 7alzA
3nvtA 1.95 angstrom crystal structure of a bifunctional 3-deoxy-7- phosphoheptulonate synthase/chorismate mutase (aroa) from listeria monocytogenes egd-e (see paper)
33% identity, 23% coverage: 10:92/363 of query aligns to 1:75/345 of 3nvtA
Sites not aligning to the query:
3tfcA 1.95 angstrom crystal structure of a bifunctional 3-deoxy-7- phosphoheptulonate synthase/chorismate mutase (aroa) from listeria monocytogenes egd-e in complex with phosphoenolpyruvate (see paper)
32% identity, 23% coverage: 11:92/363 of query aligns to 1:74/343 of 3tfcA
Sites not aligning to the query:
>WP_019556286.1 NCBI__GCF_000381085.1:WP_019556286.1
MTTEQMQLTEIRNQIDTIDAQIQDLIGQRAACAQKVADIKTQGDNVDAVFYRPEREAQVL
RAVKARNTSLLPDEEMAKLFREIMSACLALEQPTTVAYLGPEGSYSHASVIKQFGSSVHS
IAVSTIEEVFEAVEKGDASYGMVPVENSSEGVVKSTQNALVTTDLKVSGEVALEIHHCLL
SKSKTVENIHKIVAHQQALGQCEQWIKNNLPWAEIEAVASNALAAKMAKTDSAVAAIASE
QAAQLYQLNILESHIEDQSDNSTKFWVVGRDATQSSGEDKTAMIVSMKNQSGALLDILSC
FSSRGINMTRIISRPSLDTTWDYQFFIDVMGHQEDENLKQALAEVKSKSAFFKLLGSFPV
SPL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory