Comparing WP_019557130.1 NCBI__GCF_000381085.1:WP_019557130.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6y88B Igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp (see paper)
57% identity, 99% coverage: 2:263/264 of query aligns to 1:263/265 of 6y88B
6y88G Igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp (see paper)
57% identity, 91% coverage: 25:263/264 of query aligns to 15:250/253 of 6y88G
1piiA Three-dimensional structure of the bifunctional enzyme phosphoribosylanthranilate isomerase: indoleglycerolphosphate synthase from escherichia coli refined at 2.0 angstroms resolution (see paper)
41% identity, 93% coverage: 5:250/264 of query aligns to 3:240/452 of 1piiA
Sites not aligning to the query:
1jcmP Trpc stability mutant containing an engineered disulphide bridge and in complex with a cdrp-related substrate (see paper)
41% identity, 93% coverage: 6:250/264 of query aligns to 4:240/259 of 1jcmP
3t55A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with phenoxymethyl benzoic acid (pmba)
39% identity, 79% coverage: 57:264/264 of query aligns to 49:256/258 of 3t55A
3t44A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with indole glycerol phosphate (igp) amd anthranilate
39% identity, 79% coverage: 57:264/264 of query aligns to 49:256/259 of 3t44A
1vc4B Crystal structure of indole-3-glycerol phosphate synthase (trpc) from thermus thermophilus at 1.8 a resolution (see paper)
41% identity, 86% coverage: 38:264/264 of query aligns to 29:254/254 of 1vc4B
3t78A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with 5-fluoroanthranilate
39% identity, 78% coverage: 58:264/264 of query aligns to 50:254/257 of 3t78A
7etyA Crystal structure of bifunctional indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase (trpc) from corynebacterium glutamicum in complex with reduced 1-(o-carboxyphenylamino)-1- deoxyribulose 5-phosphate (rcdrp) (see paper)
34% identity, 95% coverage: 4:254/264 of query aligns to 2:245/470 of 7etyA
Sites not aligning to the query:
7etxA Crystal structure of bifunctional indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase (trpc) from corynebacterium glutamicum (see paper)
34% identity, 95% coverage: 4:254/264 of query aligns to 4:247/472 of 7etxA
Sites not aligning to the query:
1lbfA Crystal structure of indole-3-glycerol phosphate syntase (igps)with reduced 1-(o-caboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) (see paper)
37% identity, 78% coverage: 56:262/264 of query aligns to 45:245/247 of 1lbfA
Sites not aligning to the query:
1jukA Indole-3-glycerolphosphate synthase from sulfolobus solfataricus in a trigonal crystal form (see paper)
37% identity, 78% coverage: 56:262/264 of query aligns to 45:245/247 of 1jukA
1igsA Indole-3-glycerolphosphate synthase from sulfolobus solfataricus at 2.0 a resolution (see paper)
37% identity, 78% coverage: 56:262/264 of query aligns to 45:245/247 of 1igsA
1a53A Complex of indole-3-glycerolphosphate synthase from sulfolobus solfataricus with indole-3-glycerolphosphate at 2.0 a resolution (see paper)
37% identity, 78% coverage: 56:262/264 of query aligns to 45:245/247 of 1a53A
3t40A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) complex with n-2-carboxyphenyl glycine (cpg)
37% identity, 79% coverage: 57:264/264 of query aligns to 49:242/251 of 3t40A
4iwwA Computational design of an unnatural amino acid metalloprotein with atomic level accuracy (see paper)
35% identity, 78% coverage: 56:262/264 of query aligns to 45:245/247 of 4iwwA
3uxdA Designed protein ke59 r1 7/10h with dichlorobenzotriazole (dbt) (see paper)
31% identity, 89% coverage: 30:263/264 of query aligns to 16:246/247 of 3uxdA
4ou1A Crystal structure of a computationally designed retro-aldolase covalently bound to folding probe 1 [(6-methoxynaphthalen-2-yl) (oxiran-2-yl)methanol] (see paper)
33% identity, 78% coverage: 56:262/264 of query aligns to 45:245/247 of 4ou1A
5k7jA Structure of designed zinc binding protein ze2 bound to zn2+ (see paper)
33% identity, 78% coverage: 56:262/264 of query aligns to 45:238/240 of 5k7jA
3nz1A Crystal structure of kemp elimination catalyst 1a53-2 complexed with transition state analog 5-nitro benzotriazole (see paper)
31% identity, 78% coverage: 56:262/264 of query aligns to 45:245/249 of 3nz1A
>WP_019557130.1 NCBI__GCF_000381085.1:WP_019557130.1
MATPTILKKIILRKLEEIQDGCDKIPLREMKRRALLAPETKSFVGAMQAKLDAGQSAVIA
EIKKASPSKGVLRESFDPVEIAKSYAANGAACLSVLTDKDFFQGSNEYLQQVREAVDLPI
IRKDFIVDDYQVYEARAIGADCILLIAAAIGDAQMSELTQVALTLDMDVLIEVHNKEELE
RALHLPLPMIGINNRDLHSFEVSLDTTIEMLEMIPEDRIVITESGILTKGDVARMRACHV
DAFLVGEAFMRAENPGEKLAELFN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory