Comparing WP_019557256.1 NCBI__GCF_000381085.1:WP_019557256.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
6j2lA Crystal structure of bi-functional enzyme (see paper)
38% identity, 64% coverage: 5:76/112 of query aligns to 114:178/200 of 6j2lA
Sites not aligning to the query:
7bgnA Crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
34% identity, 74% coverage: 17:99/112 of query aligns to 121:204/204 of 7bgnA
Sites not aligning to the query:
7bgmA Crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
38% identity, 57% coverage: 36:99/112 of query aligns to 156:213/213 of 7bgmA
Sites not aligning to the query:
>WP_019557256.1 NCBI__GCF_000381085.1:WP_019557256.1
MSNVLKQLDAVLEARKLESADSSYVASLYSKGTEKILKKIGEEANETIMAAKDLEHVNNL
ENKEHLVYEIADLWFHTMVLLASQNLSSEDITNELQRRFGLSGHDEKASRDQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory