Comparing WP_019745160.1 NCBI__GCF_002893965.1:WP_019745160.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
A0A0H2ZQB9 Ergothioneine transporter EgtUBC from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
35% identity, 70% coverage: 57:207/215 of query aligns to 57:203/506 of A0A0H2ZQB9
Sites not aligning to the query:
B5Z7I3 Ergothioneine transport permease/ergothioneine binding protein EgtU from Helicobacter pylori (strain G27) (see paper)
34% identity, 63% coverage: 38:173/215 of query aligns to 76:211/553 of B5Z7I3
Sites not aligning to the query:
>WP_019745160.1 NCBI__GCF_002893965.1:WP_019745160.1
MGALWDFVVARRQQLMTDSYLHVSAVIQSVIIATIAAVIIGILVYRSPAGSSIATALAST
ILTVPSFALLGLLIPILGLGVAPTITALILYALLPIIRNTIIGLDAVNPAITDAARGVGM
NRMHVLSRIELPIAWPSILTGMRVSTQMLMGILAIAAYAKGPGLGNLIFSGLSRVGSPNA
VPQALVGTVLIVILALILDGIYVVIGRLTTSKGLQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory