Comparing WP_020173309.1 NCBI__GCF_000385335.1:WP_020173309.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
44% identity, 97% coverage: 7:380/385 of query aligns to 5:371/375 of 4pqaA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
44% identity, 97% coverage: 7:380/385 of query aligns to 5:371/376 of 4o23A
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
45% identity, 95% coverage: 18:381/385 of query aligns to 16:372/377 of 7t1qA
7lgpB Dape enzyme from shigella flexneri
43% identity, 97% coverage: 9:381/385 of query aligns to 9:373/377 of 7lgpB
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
41% identity, 96% coverage: 10:380/385 of query aligns to 8:371/377 of P44514
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
41% identity, 96% coverage: 10:380/385 of query aligns to 12:375/380 of 5vo3A
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
47% identity, 46% coverage: 10:187/385 of query aligns to 8:180/265 of 4op4B
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
46% identity, 46% coverage: 10:187/385 of query aligns to 10:182/258 of 4h2kA
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium
27% identity, 97% coverage: 10:384/385 of query aligns to 13:382/383 of 7uoiA
7rsfA Acetylornithine deacetylase from escherichia coli
29% identity, 53% coverage: 9:212/385 of query aligns to 7:203/380 of 7rsfA
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
28% identity, 81% coverage: 69:379/385 of query aligns to 99:413/426 of 3pfoA
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
29% identity, 42% coverage: 67:229/385 of query aligns to 119:285/503 of Q8C165
Sites not aligning to the query:
4mmoA The crystal structure of a m20 family metallo-carboxypeptidase sso-cp2 from sulfolobus solfataricus
29% identity, 44% coverage: 58:225/385 of query aligns to 54:221/437 of 4mmoA
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
34% identity, 21% coverage: 66:147/385 of query aligns to 83:164/458 of 2pokA
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
31% identity, 31% coverage: 71:188/385 of query aligns to 129:246/507 of Q96KN2
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
33% identity, 26% coverage: 71:170/385 of query aligns to 98:197/471 of 3dljA
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
25% identity, 70% coverage: 15:283/385 of query aligns to 22:294/408 of Q03154
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
26% identity, 96% coverage: 15:382/385 of query aligns to 22:396/407 of P37111
Sites not aligning to the query:
1lfwA Crystal structure of pepv (see paper)
24% identity, 88% coverage: 45:381/385 of query aligns to 53:463/468 of 1lfwA
P45494 Beta-Ala-Xaa dipeptidase; Beta-Ala-His dipeptidase; Peptidase V; EC 3.4.13.- from Lactobacillus delbrueckii subsp. lactis (see paper)
24% identity, 88% coverage: 45:381/385 of query aligns to 53:463/470 of P45494
>WP_020173309.1 NCBI__GCF_000385335.1:WP_020173309.1
MPSPATSPDLCQALIRCPSVTPQDGGSLALLESVLKGAGFTAERITFSEPGQPDIENLYA
RIGTAAPYLIFAGHTDVVPIGDRTQWRFDPFSGEITEGAIWGRGASDMKGAVAAFAMAAS
AYVAKHGVPKGSIGFLITGDEEGPAINGTVKLLDWATSKGEHFDHCIVGEPTNPDALGDM
IKIGRRGSLNGTLSVYGKQGHVAYPHRAENPIPWLARFIEVLNGMPLDDGTPHFDASNLE
IVNVDVGNPAWNVIPAEAKARFNIRFNDLWTPETLAEELQRRCGLLQAPLRFDLHFEPCN
ALAFVTMPDRFTELVAQAIETHTGRKPALSTTGGTSDARFIRAFCPVLEFGLVGATMHAV
NEHVAVADVEMLTKIYESILEAYFG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory