SitesBLAST
Comparing WP_020176090.1 NCBI__GCF_000385335.1:WP_020176090.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3daaA Crystallographic structure of d-amino acid aminotransferase inactivated by pyridoxyl-d-alanine (see paper)
42% identity, 93% coverage: 8:278/291 of query aligns to 6:272/277 of 3daaA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K149), E177 (= E182), L201 (= L207)
- binding n-(5'-phosphopyridoxyl)-d-alanine: Y31 (= Y33), R50 (= R52), K145 (= K149), E177 (= E182), S180 (= S185), S181 (= S186), L201 (= L207), G203 (= G209), I204 (≠ V210), T205 (= T211), S240 (≠ A246), T241 (≠ A247)
2daaA Crystallographic structure of d-amino acid aminotransferase inactivated by d-cycloserine
42% identity, 93% coverage: 8:278/291 of query aligns to 6:272/277 of 2daaA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K149), E177 (= E182), L201 (= L207)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: Y31 (= Y33), V33 (= V35), R50 (= R52), R98 (= R100), H100 (= H102), K145 (= K149), E177 (= E182), S180 (= S185), S181 (= S186), N182 (= N187), L201 (= L207), G203 (= G209), I204 (≠ V210), T205 (= T211), T241 (≠ A247)
1daaA Crystallographic structure of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate (see paper)
42% identity, 93% coverage: 8:278/291 of query aligns to 6:272/277 of 1daaA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K149), E177 (= E182), L201 (= L207)
- binding pyridoxal-5'-phosphate: R50 (= R52), K145 (= K149), E177 (= E182), S180 (= S185), S181 (= S186), L201 (= L207), G203 (= G209), I204 (≠ V210), T205 (= T211), S240 (≠ A246), T241 (≠ A247)
P19938 D-alanine aminotransferase; D-amino acid aminotransferase; D-amino acid transaminase; DAAT; D-aspartate aminotransferase; EC 2.6.1.21 from Bacillus sp. (strain YM-1) (see 5 papers)
41% identity, 95% coverage: 8:284/291 of query aligns to 7:279/283 of P19938
- Y32 (= Y33) binding
- R51 (= R52) binding
- R99 (= R100) binding
- H101 (= H102) binding
- K146 (= K149) active site, Proton acceptor; modified: N6-(pyridoxal phosphate)lysine
- E178 (= E182) binding ; mutation to K: Loss of transaminase activity and small gain in racemase activity.
- L202 (= L207) mutation to A: Inactivates enzyme.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3lqsA Complex structure of d-amino acid aminotransferase and 4-amino-4,5- dihydro-thiophenecarboxylic acid (adta) (see paper)
41% identity, 95% coverage: 8:284/291 of query aligns to 6:278/280 of 3lqsA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K149), E177 (= E182), L201 (= L207)
- binding 4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]thiophene-2-carboxylic acid: V33 (= V35), R50 (= R52), E177 (= E182), S180 (= S185), S181 (= S186), N182 (= N187), L201 (= L207), G203 (= G209), I204 (≠ V210), T205 (= T211), S240 (≠ A246), T241 (≠ A247), T242 (= T248)
1a0gB L201a mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate (see paper)
41% identity, 93% coverage: 8:278/291 of query aligns to 6:272/282 of 1a0gB
- active site: Y31 (= Y33), V33 (= V35), K145 (= K149), E177 (= E182), A201 (≠ L207)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R50 (= R52), K145 (= K149), E177 (= E182), S180 (= S185), S181 (= S186), G203 (= G209), I204 (≠ V210), T205 (= T211), S240 (≠ A246), T241 (≠ A247)
5e25A Crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate (see paper)
33% identity, 95% coverage: 4:280/291 of query aligns to 4:280/290 of 5e25A
- active site: F33 (≠ Y33), G35 (≠ V35), K151 (= K149), E184 (= E182), L207 (= L207)
- binding 2-oxoglutaric acid: Y88 (≠ F88), K151 (= K149), T247 (≠ A247), A248 (≠ T248)
- binding pyridoxal-5'-phosphate: R52 (= R52), K151 (= K149), Y155 (≠ L153), E184 (= E182), G187 (≠ S185), D188 (≠ S186), L207 (= L207), G209 (= G209), I210 (≠ V210), T211 (= T211), G246 (≠ A246), T247 (≠ A247)
5mr0D Thermophilic archaeal branched-chain amino acid transaminases from geoglobus acetivorans and archaeoglobus fulgidus: biochemical and structural characterisation (see paper)
32% identity, 95% coverage: 5:280/291 of query aligns to 4:279/290 of 5mr0D
- active site: F32 (≠ Y33), G34 (≠ V35), K150 (= K149), E183 (= E182), L206 (= L207)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R51 (= R52), G100 (= G103), L101 (≠ F104), K150 (= K149), Y154 (≠ L153), E183 (= E182), G186 (≠ S185), D187 (≠ S186), L206 (= L207), I209 (≠ V210), T210 (= T211), G245 (≠ A246), T246 (≠ A247)
7p3tB Transaminase of gamma-proteobacterium (see paper)
30% identity, 99% coverage: 4:290/291 of query aligns to 5:283/299 of 7p3tB
- binding pyridoxal-5'-phosphate: R53 (= R52), K153 (= K144), R157 (≠ L153), E186 (= E182), S187 (≠ G183), A188 (= A184), A189 (≠ S185), S190 (= S186), G210 (= G209), I211 (≠ V210), T212 (= T211), T248 (≠ A247)
7z79B Crystal structure of aminotransferase-like protein from variovorax paradoxus
31% identity, 95% coverage: 4:278/291 of query aligns to 17:291/306 of 7z79B
- binding pyridoxal-5'-phosphate: W46 (≠ Y33), R65 (= R52), N166 (≠ K149), S202 (= S185), T203 (≠ S186), F222 (≠ L207), G224 (= G209), I225 (≠ V210), T226 (= T211), G261 (≠ A246), T262 (≠ A247)
6xu3B (R)-selective amine transaminase from shinella sp. (see paper)
28% identity, 97% coverage: 4:286/291 of query aligns to 28:311/321 of 6xu3B
- active site: Y57 (= Y33), K177 (= K149), E210 (= E182), L232 (= L207)
- binding 3-aminobenzoic acid: P169 (≠ T138), D173 (≠ R145), K229 (≠ H204)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: R76 (= R52), Y112 (≠ F88), K177 (= K149), F184 (≠ N156), E210 (= E182), G213 (≠ S185), F214 (≠ S186), N215 (= N187), L232 (= L207), G234 (= G209), V235 (= V210), T236 (= T211), T272 (≠ A247)
6xu3A (R)-selective amine transaminase from shinella sp. (see paper)
28% identity, 97% coverage: 4:286/291 of query aligns to 27:310/320 of 6xu3A
- active site: Y56 (= Y33), K176 (= K149), E209 (= E182), L231 (= L207)
- binding pyridoxal-5'-phosphate: R75 (= R52), K176 (= K149), F183 (≠ N156), E209 (= E182), G212 (≠ S185), F213 (≠ S186), L231 (= L207), G233 (= G209), V234 (= V210), T235 (= T211), T271 (≠ A247)
6xu3C (R)-selective amine transaminase from shinella sp. (see paper)
28% identity, 97% coverage: 4:286/291 of query aligns to 29:312/322 of 6xu3C
- active site: Y58 (= Y33), K178 (= K149), E211 (= E182), L233 (= L207)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: V60 (= V35), R77 (= R52), K178 (= K149), F185 (≠ N156), E211 (= E182), G214 (≠ S185), N216 (= N187), L233 (= L207), G235 (= G209), V236 (= V210), T237 (= T211), T272 (≠ A246), T273 (≠ A247), A274 (≠ T248)
2ej0B Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase with pyridoxamine 5'-phosphate
28% identity, 95% coverage: 6:281/291 of query aligns to 8:289/305 of 2ej0B
- active site: F35 (≠ Y33), G37 (≠ V35), K158 (vs. gap), E192 (= E182), L215 (= L207)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R58 (= R52), Y163 (≠ L153), E192 (= E182), G195 (≠ S185), E196 (≠ S186), L215 (= L207), G217 (= G209), I218 (≠ V210), T219 (= T211), G254 (≠ A246), T255 (≠ A247)
6xwbA Crystal structure of an r-selective transaminase from thermomyces stellatus. (see paper)
26% identity, 95% coverage: 4:280/291 of query aligns to 29:306/319 of 6xwbA
- binding pyridoxal-5'-phosphate: R77 (= R52), K178 (= K149), F185 (≠ N156), E211 (= E182), G214 (≠ S185), F215 (≠ S186), N216 (= N187), L233 (= L207), G235 (= G209), V236 (= V210), T237 (= T211), T273 (≠ A247)
6snlD (R)-selective amine transaminase from exophiala sideris (see paper)
28% identity, 93% coverage: 4:274/291 of query aligns to 28:300/320 of 6snlD
- active site: Y57 (= Y33), K178 (≠ L158), E211 (= E182), L233 (= L207)
- binding pyridoxal-5'-phosphate: R76 (= R52), K178 (≠ L158), E211 (= E182), G214 (≠ S185), F215 (≠ S186), L233 (= L207), G235 (= G209), V236 (= V210), T237 (= T211), T273 (≠ A247)
2ej3A Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with gabapentin
27% identity, 96% coverage: 4:281/291 of query aligns to 6:281/297 of 2ej3A
- active site: F35 (≠ Y33), G37 (≠ V35), K150 (vs. gap), E184 (= E182), L207 (= L207)
- binding [1-(aminomethyl)cyclohexyl]acetic acid: G187 (≠ S185), G246 (≠ A246), T247 (≠ A247), A248 (≠ T248)
- binding pyridoxal-5'-phosphate: R58 (= R52), K150 (vs. gap), Y155 (≠ L153), E184 (= E182), G187 (≠ S185), L207 (= L207), G209 (= G209), I210 (≠ V210), T211 (= T211), G246 (≠ A246), T247 (≠ A247)
2eiyA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with 4-methylvaleric acid
27% identity, 96% coverage: 4:281/291 of query aligns to 6:281/297 of 2eiyA
- active site: F35 (≠ Y33), G37 (≠ V35), K150 (vs. gap), E184 (= E182), L207 (= L207)
- binding 4-methyl valeric acid: F35 (≠ Y33), Y94 (= Y90), T247 (≠ A247), A248 (≠ T248)
- binding pyridoxal-5'-phosphate: R58 (= R52), K150 (vs. gap), Y155 (≠ L153), E184 (= E182), G187 (≠ S185), E188 (≠ S186), L207 (= L207), G209 (= G209), I210 (≠ V210), T211 (= T211), G246 (≠ A246), T247 (≠ A247)
1wrvA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase
27% identity, 96% coverage: 4:281/291 of query aligns to 6:281/297 of 1wrvA
- active site: F35 (≠ Y33), G37 (≠ V35), K150 (vs. gap), E184 (= E182), L207 (= L207)
- binding pyridoxal-5'-phosphate: R58 (= R52), K150 (vs. gap), Y155 (≠ L153), E184 (= E182), G187 (≠ S185), L207 (= L207), G209 (= G209), I210 (≠ V210), T211 (= T211), T247 (≠ A247)
4ce5B First crystal structure of an (r)-selective omega-transaminase from aspergillus terreus (see paper)
26% identity, 93% coverage: 4:274/291 of query aligns to 31:302/325 of 4ce5B
- active site: Y60 (= Y33), K180 (= K149), E213 (= E182), L235 (= L207)
- binding calcium ion: D67 (= D40), R69 (≠ A42)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-d-glutamic acid: V62 (= V35), R79 (= R52), K180 (= K149), W184 (≠ L153), E213 (= E182), G216 (≠ S185), F217 (≠ S186), N218 (= N187), L235 (= L207), G237 (= G209), V238 (= V210), T239 (= T211), T274 (≠ A246), T275 (≠ A247), A276 (≠ T248)
- binding pyridoxal-5'-phosphate: R79 (= R52), K180 (= K149), E213 (= E182), G216 (≠ S185), F217 (≠ S186), L235 (= L207), G237 (= G209), V238 (= V210), T239 (= T211), T275 (≠ A247)
Query Sequence
>WP_020176090.1 NCBI__GCF_000385335.1:WP_020176090.1
MSRIAYVNGQYLPQSLAMVPIEDRGYQFADGVYEVCEVFDGALIDEPHHMARLARSLSEL
RIDMPLAGDALPVVLREVMRRNRLTNGFLYLQVTRGVAPRDHGFPQKPVRPALVVTAKSV
DPGKGEALARKGIAIASTADIRWKRVDIKSISLLPNVLAKQEARDKGCYEAWLIDEKGFV
TEGASSNAWIITQDGTIVTRAADHAILRGVTRTTLMKLIAELQLPVEERSFTLAEALAAR
EAFISAATNLVMPVVTIDGHQIGDGRPGPIATRLRSLFHEAAAKTEWAARR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory