SitesBLAST
Comparing WP_020563279.1 NCBI__GCF_000372865.1:WP_020563279.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2y4rA Crystal structure of 4-amino-4-deoxychorismate lyase from pseudomonas aeruginosa (see paper)
46% identity, 96% coverage: 4:267/276 of query aligns to 4:266/270 of 2y4rA
- active site: F26 (= F26), T28 (= T28), K139 (= K140), E172 (= E173), V196 (= V197)
- binding pyridoxal-5'-phosphate: R45 (= R45), K139 (= K140), S176 (≠ T177), V196 (= V197), G198 (= G199), V199 (≠ I200), N235 (= N236), S236 (= S237)
1i2lA Deoxychorismate lyase from escherichia coli with inhibitor
40% identity, 92% coverage: 1:253/276 of query aligns to 1:253/269 of 1i2lA
- active site: F26 (= F26), T28 (= T28), I139 (= I139), K140 (= K140), E173 (= E173), V197 (= V197)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: R45 (= R45), K140 (= K140), E173 (= E173), C175 (≠ T175), A176 (≠ M176), A177 (≠ T177), N178 (= N178), V197 (= V197), G199 (= G199), I200 (= I200), M201 (≠ I201), N236 (= N236), A237 (≠ S237)
1i2kA Aminodeoxychorismate lyase from escherichia coli
40% identity, 92% coverage: 1:253/276 of query aligns to 1:253/269 of 1i2kA
- active site: F26 (= F26), T28 (= T28), I139 (= I139), K140 (= K140), E173 (= E173), V197 (= V197)
- binding pyridoxal-5'-phosphate: R45 (= R45), K140 (= K140), E173 (= E173), A176 (≠ M176), A177 (≠ T177), V197 (= V197), G199 (= G199), I200 (= I200), M201 (≠ I201), N236 (= N236), A237 (≠ S237)
5e25A Crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate (see paper)
32% identity, 90% coverage: 1:249/276 of query aligns to 4:264/290 of 5e25A
- active site: F33 (= F26), G35 (≠ T28), K151 (= K140), E184 (= E173), L207 (≠ V197)
- binding 2-oxoglutaric acid: Y88 (≠ V78), K151 (= K140), T247 (≠ S237), A248 (≠ I238)
- binding pyridoxal-5'-phosphate: R52 (= R45), K151 (= K140), Y155 (≠ R144), E184 (= E173), G187 (≠ M176), D188 (≠ T177), L207 (≠ V197), G209 (= G199), I210 (= I200), T211 (≠ I201), G246 (≠ N236), T247 (≠ S237)
5mr0D Thermophilic archaeal branched-chain amino acid transaminases from geoglobus acetivorans and archaeoglobus fulgidus: biochemical and structural characterisation (see paper)
31% identity, 89% coverage: 2:247/276 of query aligns to 4:256/290 of 5mr0D
- active site: F32 (= F26), G34 (≠ T28), K150 (= K140), E183 (= E173), L206 (≠ V197)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R51 (= R45), G100 (= G91), L101 (≠ Y92), K150 (= K140), Y154 (≠ R144), E183 (= E173), G186 (≠ M176), D187 (≠ T177), L206 (≠ V197), I209 (= I200), T210 (≠ I201), G245 (≠ N236), T246 (≠ S237)
1iyeA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase (see paper)
29% identity, 95% coverage: 2:262/276 of query aligns to 5:282/304 of 1iyeA
- active site: F33 (= F26), G35 (≠ T28), K156 (= K140), A157 (≠ H141), E190 (= E173), L214 (≠ V197)
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: R56 (= R45), Y92 (≠ V78), Y126 (= Y112), K156 (= K140), Y161 (≠ R144), E190 (= E173), G193 (≠ M176), E194 (≠ T177), N195 (= N178), L214 (≠ V197), G216 (= G199), I217 (= I200), T218 (≠ I201), G253 (≠ N236), T254 (≠ S237), A255 (≠ I238)
1iydA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase (see paper)
29% identity, 95% coverage: 2:262/276 of query aligns to 5:282/304 of 1iydA
- active site: F33 (= F26), G35 (≠ T28), K156 (= K140), A157 (≠ H141), E190 (= E173), L214 (≠ V197)
- binding glutaric acid: Y92 (≠ V78), Y126 (= Y112), A255 (≠ I238)
- binding pyridoxal-5'-phosphate: R56 (= R45), K156 (= K140), Y161 (≠ R144), E190 (= E173), G193 (≠ M176), E194 (≠ T177), L214 (≠ V197), G216 (= G199), I217 (= I200), T218 (≠ I201), T254 (≠ S237)
1i1mA Crystal structure of escherichia coli branched-chain amino acid aminotransferase. (see paper)
29% identity, 95% coverage: 2:262/276 of query aligns to 5:282/304 of 1i1mA
- active site: K156 (= K140)
- binding 4-methyl valeric acid: Y92 (≠ V78), K156 (= K140), T254 (≠ S237), A255 (≠ I238)
- binding pyridoxal-5'-phosphate: R56 (= R45), K156 (= K140), Y161 (≠ R144), E190 (= E173), G193 (≠ M176), E194 (≠ T177), L214 (≠ V197), G216 (= G199), I217 (= I200), T218 (≠ I201), G253 (≠ N236), T254 (≠ S237)
1i1lA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase. (see paper)
29% identity, 95% coverage: 2:262/276 of query aligns to 5:282/304 of 1i1lA
- active site: K156 (= K140)
- binding 2-methylleucine: Y92 (≠ V78), K156 (= K140), T254 (≠ S237), A255 (≠ I238)
- binding pyridoxal-5'-phosphate: R56 (= R45), K156 (= K140), Y161 (≠ R144), E190 (= E173), G193 (≠ M176), G216 (= G199), I217 (= I200), T218 (≠ I201), T254 (≠ S237)
3lqsA Complex structure of d-amino acid aminotransferase and 4-amino-4,5- dihydro-thiophenecarboxylic acid (adta) (see paper)
28% identity, 91% coverage: 12:262/276 of query aligns to 17:269/280 of 3lqsA
- active site: Y31 (≠ F26), V33 (≠ T28), K145 (= K140), E177 (= E173), L201 (≠ V197)
- binding 4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]thiophene-2-carboxylic acid: V33 (≠ T28), R50 (= R45), E177 (= E173), S180 (≠ M176), S181 (≠ T177), N182 (= N178), L201 (≠ V197), G203 (= G199), I204 (= I200), T205 (≠ I201), S240 (≠ N236), T241 (≠ S237), T242 (≠ I238)
P19938 D-alanine aminotransferase; D-amino acid aminotransferase; D-amino acid transaminase; DAAT; D-aspartate aminotransferase; EC 2.6.1.21 from Bacillus sp. (strain YM-1) (see 5 papers)
28% identity, 91% coverage: 12:262/276 of query aligns to 18:270/283 of P19938
- Y32 (≠ F26) binding
- R51 (= R45) binding
- R99 (= R90) binding
- H101 (≠ Y92) binding
- K146 (= K140) active site, Proton acceptor; modified: N6-(pyridoxal phosphate)lysine
- E178 (= E173) binding ; mutation to K: Loss of transaminase activity and small gain in racemase activity.
- L202 (≠ V197) mutation to A: Inactivates enzyme.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3daaA Crystallographic structure of d-amino acid aminotransferase inactivated by pyridoxyl-d-alanine (see paper)
28% identity, 91% coverage: 12:262/276 of query aligns to 17:269/277 of 3daaA
- active site: Y31 (≠ F26), V33 (≠ T28), K145 (= K140), E177 (= E173), L201 (≠ V197)
- binding n-(5'-phosphopyridoxyl)-d-alanine: Y31 (≠ F26), R50 (= R45), K145 (= K140), E177 (= E173), S180 (≠ M176), S181 (≠ T177), L201 (≠ V197), G203 (= G199), I204 (= I200), T205 (≠ I201), S240 (≠ N236), T241 (≠ S237)
2daaA Crystallographic structure of d-amino acid aminotransferase inactivated by d-cycloserine
28% identity, 91% coverage: 12:262/276 of query aligns to 17:269/277 of 2daaA
- active site: Y31 (≠ F26), V33 (≠ T28), K145 (= K140), E177 (= E173), L201 (≠ V197)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: Y31 (≠ F26), V33 (≠ T28), R50 (= R45), R98 (= R90), H100 (≠ Y92), K145 (= K140), E177 (= E173), S180 (≠ M176), S181 (≠ T177), N182 (= N178), L201 (≠ V197), G203 (= G199), I204 (= I200), T205 (≠ I201), T241 (≠ S237)
1daaA Crystallographic structure of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate (see paper)
28% identity, 91% coverage: 12:262/276 of query aligns to 17:269/277 of 1daaA
- active site: Y31 (≠ F26), V33 (≠ T28), K145 (= K140), E177 (= E173), L201 (≠ V197)
- binding pyridoxal-5'-phosphate: R50 (= R45), K145 (= K140), E177 (= E173), S180 (≠ M176), S181 (≠ T177), L201 (≠ V197), G203 (= G199), I204 (= I200), T205 (≠ I201), S240 (≠ N236), T241 (≠ S237)
1a0gB L201a mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate (see paper)
28% identity, 91% coverage: 12:262/276 of query aligns to 17:269/282 of 1a0gB
- active site: Y31 (≠ F26), V33 (≠ T28), K145 (= K140), E177 (= E173), A201 (≠ V197)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R50 (= R45), K145 (= K140), E177 (= E173), S180 (≠ M176), S181 (≠ T177), G203 (= G199), I204 (= I200), T205 (≠ I201), S240 (≠ N236), T241 (≠ S237)
8pnyA Crystal structure of d-amino acid aminotransferase from blastococcus saxobsidens complexed with phenylhydrazine and in its apo form (see paper)
27% identity, 89% coverage: 16:262/276 of query aligns to 26:274/278 of 8pnyA
- binding [6-methyl-5-oxidanyl-4-[(2-phenylhydrazinyl)methyl]pyridin-3-yl]methyl dihydrogen phosphate: F36 (= F26), S38 (≠ T28), R55 (= R45), K152 (= K140), Y156 (≠ R144), E185 (= E173), G186 (= G174), P187 (≠ T175), T188 (≠ M176), S189 (≠ T177), T190 (≠ N178), L209 (≠ V197), T212 (≠ I200), T213 (≠ I201), S248 (≠ N236), G249 (≠ S237)
8pnwA Crystal structure of d-amino acid aminotransferase from blastococcus saxobsidens in holo form with plp (see paper)
27% identity, 89% coverage: 16:262/276 of query aligns to 26:274/278 of 8pnwA
- binding pyridoxal-5'-phosphate: R55 (= R45), K152 (= K140), Y156 (≠ R144), E185 (= E173), P187 (≠ T175), T188 (≠ M176), S189 (≠ T177), L209 (≠ V197), T212 (≠ I200), T213 (≠ I201), G249 (≠ S237)
7p3tB Transaminase of gamma-proteobacterium (see paper)
29% identity, 90% coverage: 1:248/276 of query aligns to 5:259/299 of 7p3tB
- binding pyridoxal-5'-phosphate: R53 (= R45), K153 (= K140), R157 (= R144), E186 (= E173), S187 (≠ G174), A188 (≠ T175), A189 (≠ M176), S190 (≠ T177), G210 (= G199), I211 (= I200), T212 (≠ I201), T248 (≠ S237)
4whxA X-ray crystal structure of an amino acid aminotransferase from burkholderia pseudomallei bound to the co-factor pyridoxal phosphate
29% identity, 96% coverage: 7:270/276 of query aligns to 17:296/306 of 4whxA
5k3wA Structural characterisation of fold iv-transaminase, cputa1, from curtobacterium pusillum (see paper)
26% identity, 88% coverage: 11:254/276 of query aligns to 31:278/298 of 5k3wA
- binding pyridoxal-5'-phosphate: R65 (= R45), K164 (= K140), Y168 (≠ R144), E197 (= E173), P199 (≠ T175), T200 (≠ M176), S201 (≠ T177), N202 (= N178), L221 (≠ V197), T224 (≠ I200), T225 (≠ I201), S261 (= S237)
Query Sequence
>WP_020563279.1 NCBI__GCF_000372865.1:WP_020563279.1
MILINGEYRDHIEISDRGFQYGDGLFETIEVHNGRPVFLNRHLHRLQTGCARLQIPCPDP
ELIRSEAAVLCKNAPHAVLKLIITRGSGGRGYRPPEATRPTRVLSLHPCPDYPGRYREQG
VAVRICQTRLGLNPALAGIKHLNRLEQVLARAEWDDPEIQEGLMLDINGHVIEGTMTNLF
YFSNRSAYTPALTQCGVDGIIRRILMDLLSKRRITVRETAPTVDELSAADEVFVCNSIIG
IWPVRAIGNVRYAVGPFTRQCQFDLTEFKNEAVHDE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory