SitesBLAST
Comparing WP_020564722.1 NCBI__GCF_000372865.1:WP_020564722.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
P0AEY3 Nucleoside triphosphate pyrophosphohydrolase; NTP-PPase; EC 3.6.1.8 from Escherichia coli (strain K12) (see paper)
49% identity, 98% coverage: 2:261/266 of query aligns to 1:258/263 of P0AEY3
- R95 (= R96) mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- K119 (= K120) mutation to A: Does not affect the nucleotide pyrophosphohydrolysis activity.
- K168 (= K173) mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- KVYEE 168:172 (≠ KVMEE 173:177) binding
- E171 (= E176) mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- E172 (= E177) mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- E175 (= E180) binding ; mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- K189 (≠ H192) mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- KLEE 189:192 (≠ HVQE 192:195) binding
- E192 (= E195) mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- E193 (= E196) mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- D196 (= D199) binding ; mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- K222 (= K225) mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- KFERR 222:226 (≠ KFSRR 225:229) binding
- R226 (= R229) mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- W253 (= W256) binding ; mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- K257 (= K260) mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
3crcA Crystal structure of escherichia coli mazg, the regulator of nutritional stress response (see paper)
45% identity, 96% coverage: 6:261/266 of query aligns to 4:223/225 of 3crcA
Q9X015 Nucleoside triphosphate pyrophosphohydrolase/pyrophosphatase MazG; NTP-PPase; EC 3.6.1.1; EC 3.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
43% identity, 96% coverage: 6:260/266 of query aligns to 9:250/255 of Q9X015
- E41 (= E39) mutation to Q: Reduces the NTPase activity to 10% of the wild-type activity; when associated with Q-42.
- E42 (= E40) mutation to Q: Reduces the NTPase activity to 10% of the wild-type activity; when associated with Q-41.
- E45 (= E43) mutation to Q: Reduces the NTPase activity to 10% of the wild-type activity.
- E61 (= E59) mutation to Q: Reduces the NTPase activity to 10% of the wild-type activity.
- R97 (= R95) mutation to A: Reduces the NTPase activity to 10% of the wild-type activity; when associated with A-98.
- R98 (= R96) mutation to A: Reduces the NTPase activity to 10% of the wild-type activity; when associated with A-97.
- K118 (= K120) mutation to E: Reduces the NTPase activity to 10% of the wild-type activity.
- E173 (= E180) mutation to A: Has little effects on the NTPase activity.
- E176 (≠ K186) mutation to A: Has little effects on the NTPase activity.
- EE 185:186 (= EE 195:196) mutation to AA: Has little effects on the NTPase activity.
3crcB Crystal structure of escherichia coli mazg, the regulator of nutritional stress response (see paper)
41% identity, 97% coverage: 3:261/266 of query aligns to 1:217/220 of 3crcB
A0R3C4 Nucleoside triphosphate pyrophosphohydrolase; NTP-PPase; EC 3.6.1.8 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
34% identity, 60% coverage: 3:162/266 of query aligns to 82:238/324 of A0R3C4
- A222 (= A146) mutation to E: Pyrophosphohydrolase activity is reduced 30-fold.
P96379 Nucleoside triphosphate pyrophosphohydrolase; NTP-PPase; EC 3.6.1.8 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 59% coverage: 6:162/266 of query aligns to 85:235/325 of P96379
- A219 (= A146) mutation to E: Pyrophosphohydrolase activity is reduced 20-fold. It affects the magnesium binding and the protein structure.
7yh5B Mazg(mycobacterium tuberculosis) (see paper)
37% identity, 34% coverage: 6:96/266 of query aligns to 85:177/177 of 7yh5B
2yxhA Crystal structure of mazg-related protein from thermotoga maritima
32% identity, 44% coverage: 5:120/266 of query aligns to 2:113/114 of 2yxhA
Query Sequence
>WP_020564722.1 NCBI__GCF_000372865.1:WP_020564722.1
MLKNTEHLLEIMARLRHPEQGCAWDLKQDFTTLIPYVIEEAYEVVDAIERNDLDDLRSEL
GDLLLQVVFHSQLADEKGLFDFEQVAASICDKLIRRHPHVFSDTVFASDEERHQAWERAK
AEERKEKHRSAAPASVLSGVAASLPALLECEKIQDRAAHHGFDWPDTLPVFDKVMEELEE
VREAWKSGDRAHVQEEVGDLLLVVVNLARHLQVNAELALKESTKKFSRRFQYIERQVEAS
GRTLADCELDELDRYWNEAKRALKKT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory