Comparing WP_022670212.1 NCBI__GCF_000420385.1:WP_022670212.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
2qhfA Mycobacterium tuberculosis chorismate synthase in complex with nca
47% identity, 99% coverage: 1:381/383 of query aligns to 1:390/392 of 2qhfA
P9WPY1 Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EC 4.2.3.5 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
47% identity, 99% coverage: 1:381/383 of query aligns to 1:390/401 of P9WPY1
2o12A Mycobacterium tuberculosis chorismate synthase in complex with fmn
47% identity, 99% coverage: 1:381/383 of query aligns to 1:384/386 of 2o12A
1qxoA Crystal structure of chorismate synthase complexed with oxidized fmn and epsp (see paper)
50% identity, 99% coverage: 2:379/383 of query aligns to 1:384/388 of 1qxoA
P0A2Y6 Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EC 4.2.3.5 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
50% identity, 99% coverage: 2:379/383 of query aligns to 1:384/388 of P0A2Y6
1um0A Crystal structure of chorismate synthase complexed with fmn (see paper)
33% identity, 93% coverage: 1:356/383 of query aligns to 7:346/365 of 1um0A
P56122 Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EC 4.2.3.5 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
33% identity, 93% coverage: 1:356/383 of query aligns to 7:346/365 of P56122
Q12640 Chorismate synthase aro-2; 5-enolpyruvylshikimate-3-phosphate phospholyase; EC 1.5.1.38; EC 4.2.3.5 from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) (see 3 papers)
32% identity, 96% coverage: 2:369/383 of query aligns to 8:402/432 of Q12640
>WP_022670212.1 NCBI__GCF_000420385.1:WP_022670212.1
MIRFLDAGESHGKALIAIIEGLPAGLKIDSDFINRQLLLRQSGYGRGGRQKIEKDRVEFL
SGVRFGETIGSPIAILIKNRDFENWRDIMEPFAEKSRQRRVNRPRPGHADLTGYLKYDRD
DIRDILERSSARETAIRVAVGSICELLLKELGVRIISFVRSIGKIKTEIKPEVNDEFERK
IIDSLVFCPDKKVEDLMIAEIEEAKKEGDTLGGVVEVVASGVVAGVGSYVQWDRRLDARV
SFSLMSIQAVKAVEIGDGFENAYKFGSQVHDEIVYDSGYKRVSNRAGGIEGGMSNGEDIV
VRAYMKPIPTLRKGLKSVNIDTHEEDISAFERSDVTAVPSLSIVARSVVAFELANLYAEK
FGGDTLKELKERVEAYKKYLSVK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory