Comparing WP_022670321.1 NCBI__GCF_000420385.1:WP_022670321.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
Q58667 Methanogen homoaconitase small subunit; HACN; Homoaconitate hydratase; EC 4.2.1.114 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
55% identity, 98% coverage: 1:159/163 of query aligns to 1:158/170 of Q58667
2pkpA Crystal structure of 3-isopropylmalate dehydratase (leud)from methhanocaldococcus jannaschii dsm2661 (mj1271) (see paper)
55% identity, 98% coverage: 1:159/163 of query aligns to 1:158/167 of 2pkpA
O14289 3-isopropylmalate dehydratase; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
39% identity, 55% coverage: 13:102/163 of query aligns to 554:655/758 of O14289
Sites not aligning to the query:
P9WK95 3-isopropylmalate dehydratase small subunit; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
40% identity, 54% coverage: 13:100/163 of query aligns to 18:110/198 of P9WK95
Sites not aligning to the query:
Q9SIB9 Aconitate hydratase 3, mitochondrial; Aconitase 3; mACO1; Citrate hydro-lyase 3; EC 4.2.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
48% identity, 31% coverage: 51:100/163 of query aligns to 861:910/990 of Q9SIB9
Sites not aligning to the query:
P19414 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
31% identity, 66% coverage: 54:160/163 of query aligns to 655:769/778 of P19414
Sites not aligning to the query:
P39533 Homocitrate dehydratase, mitochondrial; Aconitase 2; EC 4.2.1.- from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
38% identity, 40% coverage: 55:119/163 of query aligns to 661:728/789 of P39533
Sites not aligning to the query:
P20004 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Bos taurus (Bovine) (see 2 papers)
39% identity, 34% coverage: 54:109/163 of query aligns to 658:714/780 of P20004
Sites not aligning to the query:
>WP_022670321.1 NCBI__GCF_000420385.1:WP_022670321.1
MRIKGRVWVYPDNVDTDVIIPARYLNTSDPKELAKHCMEDIDENFAEQVKEGDIIVAGYN
FGSGSSREHAPIAIKASGVACVIAKSFSRIFYRNAFNIGLPILESDVSDELEKGDEIEVD
TQKGEIVVLKNGKIFKSSVIPEFMQQLIESGGLFGYAKKLLNV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory