Comparing WP_022671060.1 NCBI__GCF_000420385.1:WP_022671060.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
36% identity, 97% coverage: 5:254/259 of query aligns to 4:254/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
36% identity, 96% coverage: 5:253/259 of query aligns to 4:253/253 of 1g9xB
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
31% identity, 97% coverage: 5:254/259 of query aligns to 2:236/240 of 6mjpA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
33% identity, 96% coverage: 6:254/259 of query aligns to 3:236/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
33% identity, 96% coverage: 6:254/259 of query aligns to 3:236/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
33% identity, 96% coverage: 6:253/259 of query aligns to 3:235/235 of 6mhzA
6mbnA Lptb e163q in complex with atp (see paper)
32% identity, 96% coverage: 6:254/259 of query aligns to 4:237/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
32% identity, 95% coverage: 6:252/259 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
32% identity, 95% coverage: 6:252/259 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
32% identity, 95% coverage: 6:251/259 of query aligns to 3:233/233 of 6b8bA
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
32% identity, 85% coverage: 22:242/259 of query aligns to 19:227/253 of 6z5uK
Sites not aligning to the query:
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
32% identity, 85% coverage: 22:242/259 of query aligns to 21:229/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
32% identity, 85% coverage: 22:242/259 of query aligns to 21:229/263 of 7d08B
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 88% coverage: 18:245/259 of query aligns to 18:232/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
31% identity, 88% coverage: 18:245/259 of query aligns to 19:233/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
31% identity, 88% coverage: 18:245/259 of query aligns to 19:233/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
31% identity, 88% coverage: 18:245/259 of query aligns to 19:233/344 of 3tuiC
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
29% identity, 93% coverage: 5:245/259 of query aligns to 2:227/241 of 4u00A
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
32% identity, 98% coverage: 1:255/259 of query aligns to 1:237/285 of 4yerA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 88% coverage: 15:241/259 of query aligns to 11:223/240 of 4ymuJ
>WP_022671060.1 NCBI__GCF_000420385.1:WP_022671060.1
MSDVILKCDKITMRFGGLTAVNQFSIEVNEHMIFGIIGPNGAGKTTAFNMITGNLTPTSG
EIIFYGTNITGMKPYKIVSLGMARTFQNIRLFSNLSVIENVLTGFHHKLKYNLIDAILRT
PRFYRYEKQMREEAMMLLESVGLADKANFKASELPYGERRKVEIARALATGPKMLLLDEP
AAGMNPQETLNLMYFIQEIKDKFNLTILLIEHDMKFVMNLCERIAVLDHGVKIAEGKPEE
IQKNPDVIRAYLGDFHANG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory