Comparing WP_022947720.1 NCBI__GCF_000421465.1:WP_022947720.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6fd9A Catalytic subunit hisg from psychrobacter arcticus atp phosphoribosyltransferase (hiszg atpprt) in complex with amp
61% identity, 97% coverage: 2:206/211 of query aligns to 4:208/209 of 6fd9A
6fcwA Catalytic subunit hisg from psychrobacter arcticus atp phosphoribosyltransferase (hiszg atpprt) in complex with pratp
61% identity, 97% coverage: 2:206/211 of query aligns to 4:208/209 of 6fcwA
6fctA Catalytic subunit hisg from psychrobacter arcticus atp phosphoribosyltransferase (hiszg atpprt) in complex with prpp and atp
61% identity, 97% coverage: 2:206/211 of query aligns to 4:208/209 of 6fctA
6fcaA Catalytic subunit hisg from psychrobacter arcticus atp phosphoribosyltransferase (hiszg atpprt) in complex with prpp
61% identity, 97% coverage: 2:206/211 of query aligns to 4:208/209 of 6fcaA
6fcyA Catalytic subunit hisg from psychrobacter arcticus atp phosphoribosyltransferase (hiszg atpprt) in complex with prpp and adp
61% identity, 97% coverage: 2:206/211 of query aligns to 4:208/208 of 6fcyA
1z7nF Atp phosphoribosyl transferase (hiszg atp-prtase) from lactococcus lactis with bound prpp substrate (see paper)
41% identity, 97% coverage: 1:204/211 of query aligns to 1:205/205 of 1z7nF
1z7mE Atp phosphoribosyl transferase (hiszg atp-prtase) from lactococcus lactis (see paper)
41% identity, 96% coverage: 1:202/211 of query aligns to 1:199/200 of 1z7mE
1usyG Atp phosphoribosyl transferase (hisg:hisz) complex from thermotoga maritima (see paper)
33% identity, 98% coverage: 1:206/211 of query aligns to 1:199/203 of 1usyG
2vd3A The structure of histidine inhibited hisg from methanobacterium thermoautotrophicum
34% identity, 96% coverage: 7:208/211 of query aligns to 11:214/289 of 2vd3A
Sites not aligning to the query:
1q1kA Structure of atp-phosphoribosyltransferase from e. Coli complexed with pr-atp (see paper)
35% identity, 89% coverage: 2:188/211 of query aligns to 3:199/288 of 1q1kA
1h3dA Structure of the e.Coli atp-phosphoribosyltransferase (see paper)
35% identity, 89% coverage: 2:188/211 of query aligns to 3:199/288 of 1h3dA
1nh8A Atp phosphoribosyltransferase (atp-prtase) from mycobacterium tuberculosis in complex with amp and histidine (see paper)
34% identity, 79% coverage: 1:167/211 of query aligns to 1:167/276 of 1nh8A
Sites not aligning to the query:
5lhtA Atp phosphoribosyltransferase from mycobacterium tuberculosis in complex with the allosteric activator 3-(2-thienyl)-l-alanine (see paper)
34% identity, 79% coverage: 1:167/211 of query aligns to 1:167/284 of 5lhtA
Sites not aligning to the query:
5u99A Transition state analysis of adenosine triphosphate phosphoribosyltransferase (see paper)
34% identity, 79% coverage: 1:167/211 of query aligns to 3:169/278 of 5u99A
5ubgA Catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni with bound phosphoribosyl-atp (see paper)
30% identity, 91% coverage: 2:194/211 of query aligns to 4:206/222 of 5ubgA
5ubiA Catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni with bound prpp (see paper)
30% identity, 91% coverage: 2:194/211 of query aligns to 4:206/218 of 5ubiA
4yb7C Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with atp (see paper)
30% identity, 91% coverage: 2:194/211 of query aligns to 4:206/294 of 4yb7C
4yb7A Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with atp (see paper)
31% identity, 88% coverage: 2:187/211 of query aligns to 4:199/296 of 4yb7A
4yb6A Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with the inhibitors amp and histidine (see paper)
31% identity, 88% coverage: 2:187/211 of query aligns to 4:199/296 of 4yb6A
Sites not aligning to the query:
4yb6E Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with the inhibitors amp and histidine (see paper)
30% identity, 91% coverage: 2:194/211 of query aligns to 4:203/293 of 4yb6E
Sites not aligning to the query:
>WP_022947720.1 NCBI__GCF_000421465.1:WP_022947720.1
MLTIAVSKGRIYKEALPLLAQAGIEPTCDPDTSRKLILPTCRDDVRLLIIRATDVPTYVE
YGAADVGIAGKDVLVEHGAGSLYEPLDLGIARCRMMTAGKVGETWDARRIRVATKYVNTA
KRYFADRGIQAEVIKLYGSMELAPLVGLAECIVDLVDTGNTLRANGLEPRDLIMDISSRL
VVNKAAMKMKHAPLKQLIRDLEAAVNPEVAT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory