Comparing WP_024769669.1 NCBI__GCF_000520995.1:WP_024769669.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8j5qD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- translocation state (see paper)
38% identity, 99% coverage: 4:561/563 of query aligns to 1:604/611 of 8j5qD
8j5tD Cryo-em structure of mycobacterium tuberculosis oppabcd in the catalytic intermediate state (see paper)
38% identity, 99% coverage: 4:561/563 of query aligns to 1:604/608 of 8j5tD
8j5sD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- catalytic intermediate state (see paper)
38% identity, 99% coverage: 4:561/563 of query aligns to 1:604/608 of 8j5sD
8xfcD Cryo-em structure of the atp-bound mtb dppabcd with the d445a mutation of dppa
39% identity, 99% coverage: 6:562/563 of query aligns to 4:516/517 of 8xfcD
8wdbD Cryo-em structure of the atp-bound dppabcd complex
39% identity, 99% coverage: 6:560/563 of query aligns to 3:513/513 of 8wdbD
8z1wD Cryo-em structure of escherichia coli dppbcdf complex bound to atpgammas
45% identity, 46% coverage: 303:561/563 of query aligns to 1:259/326 of 8z1wD
Sites not aligning to the query:
8z1xD Cryo-em structure of escherichia coli dppbcdf complex bound to amppnp
45% identity, 46% coverage: 305:561/563 of query aligns to 2:258/325 of 8z1xD
Sites not aligning to the query:
8z1xC Cryo-em structure of escherichia coli dppbcdf complex bound to amppnp
47% identity, 46% coverage: 5:262/563 of query aligns to 1:257/326 of 8z1xC
Sites not aligning to the query:
8z1yC Cryo-em structure of escherichia coli dppabcdf in the pre-catalytic state
47% identity, 46% coverage: 5:262/563 of query aligns to 1:257/324 of 8z1yC
Sites not aligning to the query:
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
35% identity, 49% coverage: 6:279/563 of query aligns to 3:286/330 of P0AAH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
39% identity, 46% coverage: 4:264/563 of query aligns to 1:260/310 of 4fwiB
Sites not aligning to the query:
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
38% identity, 48% coverage: 4:274/563 of query aligns to 2:271/326 of Q8RDH4
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 44% coverage: 312:558/563 of query aligns to 2:243/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
35% identity, 44% coverage: 312:558/563 of query aligns to 3:244/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
35% identity, 44% coverage: 312:558/563 of query aligns to 3:244/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
35% identity, 44% coverage: 312:558/563 of query aligns to 3:244/344 of 3tuiC
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
34% identity, 45% coverage: 305:559/563 of query aligns to 2:247/250 of 7z18I
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
34% identity, 45% coverage: 305:559/563 of query aligns to 2:247/253 of 7z15I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
34% identity, 45% coverage: 305:559/563 of query aligns to 2:247/250 of 7z16I
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
29% identity, 45% coverage: 305:559/563 of query aligns to 1:239/241 of 4u00A
>WP_024769669.1 NCBI__GCF_000520995.1:WP_024769669.1
MNTTTLLSVQNLCVSFLSEEKENQVLYDISFDIHKNEILGVVGESGSGKSVASLAILGLL
PNKISRITKGDIIYDGVSLSNFNEKEYRAIRGNEIAMIFQEPMSSLNPSMKCGRQVAEIL
FQHTSLSKTEIKTEVLSLFEKVKLPEPDRAYKSYPHQLSGGQKQRIMIAMAIACKPKLLI
ADEPTTALDVTVQKEIIGLLKSLQEEYKMSILFISHDLSLVSEVADHVLVMYQGKMIEYG
TTNTIFHTPQKEYTKALINARPPMNIRYQKLPTIADFFEDTDQKKKIITKEQREQHHQDL
YSQPPLLEVINVEKSYFSKVGLFGKAEFKAVDDVSFKLYEGETLGLVGESGCGKSTLGNT
ILQLDKANRGQVIYKGQDITQLSSSEIRSLRKEIQLIFQDPFASLNPRLAVGKAIMEPMQ
AHNLYNNDKERKQKVIELLERVSLTEEHFNRYPHEFSGGQRQRIGIARTIALQPKLIICD
ESVSALDISVQAQVLNLLNELKSNFGFTYIFISHDLAVVKYMSDQLLVMNKGKIEEQGDA
DLIYENPQKEYTKKLIQAIPKSR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory