SitesBLAST
Comparing WP_024850313.1 NCBI__GCF_000526715.1:WP_024850313.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ed7A Crystal structure of 7,8-diaminopelargonic acid synthase bound to inhibitor mac13772
56% identity, 94% coverage: 16:430/442 of query aligns to 6:415/429 of 6ed7A
- active site: Y17 (= Y27), Y144 (= Y155), D245 (= D256), K274 (= K285)
- binding 2-[(2-nitrophenyl)sulfanyl]acetohydrazide: Y17 (= Y27), W52 (= W62), W52 (= W62), Y144 (= Y155), D147 (= D158), A217 (= A228), K274 (= K285), R391 (= R406), F393 (= F408), F393 (= F408)
- binding pyridoxal-5'-phosphate: G112 (= G122), S113 (= S123), Y144 (= Y155), H145 (= H156), D245 (= D256), I247 (= I258), K274 (= K285)
P12995 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Escherichia coli (strain K12) (see 4 papers)
56% identity, 94% coverage: 16:430/442 of query aligns to 6:415/429 of P12995
- Y17 (= Y27) mutation to F: Severely reduces the aminotransferase activity.
- W52 (= W62) binding
- GS 112:113 (= GS 122:123) binding
- Y144 (= Y155) mutation to F: Severely reduces the aminotransferase activity.
- D147 (= D158) mutation to N: Loss of aminotransferase activity.
- D245 (= D256) binding
- R253 (= R264) mutation to A: Has only a small effect on the rate of reaction with DAPA.; mutation to K: Increases aminotransferase activity toward SAM.; mutation to M: Loss of aminotransferase activity.; mutation to Q: Increases aminotransferase activity toward SAM.
- K274 (= K285) binding ; modified: N6-(pyridoxal phosphate)lysine
- G307 (= G322) binding
- PT 308:309 (= PT 323:324) binding
- R391 (= R406) binding ; mutation to A: Reduces aminotransferase activity.
1dtyA Crystal structure of adenosylmethionine-8-amino-7-oxonanoate aminotransferase with pyridoxal phosphate cofactor.
56% identity, 94% coverage: 16:430/442 of query aligns to 6:415/429 of 1dtyA
- active site: Y17 (= Y27), Y144 (= Y155), E211 (= E222), D245 (= D256), A248 (= A259), K274 (= K285), Y398 (= Y413)
- binding pyridoxal-5'-phosphate: G112 (= G122), S113 (= S123), Y144 (= Y155), H145 (= H156), D245 (= D256), I247 (= I258), K274 (= K285)
1mlzA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the trans-isomer of amiclenomycin. (see paper)
56% identity, 94% coverage: 16:430/442 of query aligns to 6:414/427 of 1mlzA
- active site: Y17 (= Y27), Y144 (= Y155), E210 (= E222), D244 (= D256), A247 (= A259), K273 (= K285), Y397 (= Y413)
- binding pyridoxal-5'-phosphate: G112 (= G122), S113 (= S123), Y144 (= Y155), H145 (= H156), D244 (= D256), I246 (= I258), K273 (= K285), P307 (= P323), T308 (= T324)
- binding trans-amiclenomycin: W52 (= W62), W53 (= W63), Y144 (= Y155), K273 (= K285), R390 (= R406), F392 (= F408)
1mlyA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the cis isomer of amiclenomycin (see paper)
56% identity, 94% coverage: 16:430/442 of query aligns to 6:414/427 of 1mlyA
- active site: Y17 (= Y27), Y144 (= Y155), E210 (= E222), D244 (= D256), A247 (= A259), K273 (= K285), Y397 (= Y413)
- binding cis-amiclenomycin: W52 (= W62), W53 (= W63), K273 (= K285), R390 (= R406), F392 (= F408)
- binding pyridoxal-5'-phosphate: G112 (= G122), S113 (= S123), Y144 (= Y155), H145 (= H156), D244 (= D256), I246 (= I258), K273 (= K285), P307 (= P323), T308 (= T324)
1qj3A Crystal structure of 7,8-diaminopelargonic acid synthase in complex with 7-keto-8-aminopelargonic acid (see paper)
55% identity, 94% coverage: 16:430/442 of query aligns to 6:403/416 of 1qj3A
- active site: Y17 (= Y27), Y144 (= Y155), E201 (= E222), D235 (= D256), A238 (= A259), K264 (= K285), Y386 (= Y413)
- binding 7-keto-8-aminopelargonic acid: Y17 (= Y27), W52 (= W62), Y144 (= Y155), K264 (= K285), R379 (= R406), F381 (= F408)
- binding pyridoxal-5'-phosphate: G112 (= G122), S113 (= S123), Y144 (= Y155), H145 (= H156), G146 (= G157), D235 (= D256), I237 (= I258), A238 (= A259), K264 (= K285)
6erkA Crystal structure of diaminopelargonic acid aminotransferase from psychrobacter cryohalolentis (see paper)
50% identity, 96% coverage: 18:442/442 of query aligns to 9:419/420 of 6erkA
4w1vA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a thiazole inhibitor (see paper)
49% identity, 95% coverage: 13:433/442 of query aligns to 4:417/425 of 4w1vA
- active site: Y18 (= Y27), Y147 (= Y155), E210 (= E222), D244 (= D256), A247 (= A259), K273 (= K285), Y397 (= Y413)
- binding dimethyl (2R)-5-(3-fluorophenyl)-1H-pyrrolo[1,2-c][1,3]thiazole-6,7-dicarboxylate 2-oxide: P17 (= P26), Y18 (= Y27), W54 (= W62), M81 (= M89), G83 (= G91), Y147 (= Y155), G306 (= G322), P307 (= P323), T308 (= T324), F392 (= F408)
- binding pyridoxal-5'-phosphate: G114 (= G122), S115 (= S123), Y147 (= Y155), H148 (= H156), E210 (= E222), D244 (= D256), I246 (= I258), K273 (= K285)
4cxrA Mycobaterium tuberculosis transaminase bioa complexed with 1-(1,3- benzothiazol-2-yl)methanamine (see paper)
49% identity, 95% coverage: 13:433/442 of query aligns to 4:417/425 of 4cxrA
- active site: Y18 (= Y27), Y147 (= Y155), E210 (= E222), D244 (= D256), A247 (= A259), K273 (= K285), Y397 (= Y413)
- binding 1-(1,3-benzothiazol-2-yl)methanamine: Y18 (= Y27), W54 (= W62), W55 (= W63), A216 (= A228)
- binding pyridoxal-5'-phosphate: G114 (= G122), S115 (= S123), Y147 (= Y155), H148 (= H156), E210 (= E222), D244 (= D256), I246 (= I258), K273 (= K285), P307 (= P323), T308 (= T324)
4cxqA Mycobaterium tuberculosis transaminase bioa complexed with substrate kapa (see paper)
49% identity, 95% coverage: 13:433/442 of query aligns to 4:419/427 of 4cxqA
- active site: Y18 (= Y27), Y149 (= Y155), E212 (= E222), D246 (= D256), A249 (= A259), K275 (= K285), Y399 (= Y413)
- binding 7-keto-8-aminopelargonic acid: W56 (= W62), Y149 (= Y155), G308 (= G322), T310 (= T324), R392 (= R406)
- binding pyridoxal-5'-phosphate: G116 (= G122), S117 (= S123), Y149 (= Y155), H150 (= H156), G151 (= G157), E212 (= E222), D246 (= D256), I248 (= I258), K275 (= K285), P309 (= P323), T310 (= T324)
3lv2A Crystal structure of mycobacterium tuberculosis 7,8-diaminopelargonic acid synthase in complex with substrate analog sinefungin (see paper)
49% identity, 95% coverage: 13:433/442 of query aligns to 5:411/421 of 3lv2A
- active site: Y143 (= Y155), E206 (= E222), D240 (= D256), A243 (= A259), K269 (= K285), Y391 (= Y413)
- binding pyridoxal-5'-phosphate: G110 (= G122), S111 (= S123), Y143 (= Y155), H144 (= H156), E206 (= E222), D240 (= D256), I242 (= I258), K269 (= K285)
- binding sinefungin: Y19 (= Y27), W50 (= W62), L369 (= L390), R384 (= R406), P385 (= P407), F386 (= F408)
5kgtA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead: 1-[4-[4-(3-chlorophenyl)carbonylpiperidin-1- yl]phenyl]ethanone (see paper)
49% identity, 95% coverage: 13:432/442 of query aligns to 4:419/429 of 5kgtA
- active site: Y18 (= Y27), Y150 (= Y155), E213 (= E222), D247 (= D256), A250 (= A259), K276 (= K285), Y400 (= Y413)
- binding 1-[4-[4-(3-chlorophenyl)carbonylpiperidin-1-yl]phenyl]ethanone: M84 (= M89), G86 (= G91), G309 (= G322), T311 (= T324)
- binding pyridoxal-5'-phosphate: S116 (= S121), G117 (= G122), S118 (= S123), Y150 (= Y155), H151 (= H156), G152 (= G157), E213 (= E222), D247 (= D256), I249 (= I258), K276 (= K285)
5kgsA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead: 5-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]-2, 3-dihydroinden-1-one (see paper)
49% identity, 95% coverage: 13:432/442 of query aligns to 4:419/429 of 5kgsA
- active site: Y18 (= Y27), Y150 (= Y155), E213 (= E222), D247 (= D256), A250 (= A259), K276 (= K285), Y400 (= Y413)
- binding 5-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]-2,3-dihydroinden-1-one: P17 (= P26), Y18 (= Y27), W57 (= W62), M84 (= M89), G86 (= G91), Y150 (= Y155), D162 (= D167), G165 (≠ N170), G166 (= G171), P310 (= P323), T311 (= T324), F395 (= F408)
- binding pyridoxal-5'-phosphate: G117 (= G122), S118 (= S123), Y150 (= Y155), H151 (= H156), G152 (= G157), E213 (= E222), D247 (= D256), I249 (= I258), K276 (= K285)
4xjpA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead (see paper)
49% identity, 95% coverage: 13:432/442 of query aligns to 4:419/429 of 4xjpA
- active site: Y18 (= Y27), Y150 (= Y155), E213 (= E222), D247 (= D256), A250 (= A259), K276 (= K285), Y400 (= Y413)
- binding 1-{4-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]phenyl}ethanone: P17 (= P26), Y18 (= Y27), W57 (= W62), M84 (= M89), G86 (= G91), Y150 (= Y155), G165 (≠ N170), G166 (= G171), A219 (= A228), G220 (= G229), G309 (= G322), F395 (= F408)
- binding pyridoxal-5'-phosphate: G117 (= G122), S118 (= S123), Y150 (= Y155), H151 (= H156), G152 (= G157), E213 (= E222), D247 (= D256), I249 (= I258), K276 (= K285), P310 (= P323), T311 (= T324)
4xjmA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a hts lead compound
49% identity, 95% coverage: 13:432/442 of query aligns to 4:419/429 of 4xjmA
- active site: Y18 (= Y27), Y150 (= Y155), E213 (= E222), D247 (= D256), A250 (= A259), K276 (= K285), Y400 (= Y413)
- binding 3-{1-[(5-acetylthiophen-2-yl)carbonyl]piperidin-4-yl}-N-(3-methoxyphenyl)propanamide: P17 (= P26), Y18 (= Y27), W57 (= W62), M84 (= M89), G86 (= G91), Y150 (= Y155), M158 (= M163), G165 (≠ N170), G166 (= G171), M167 (= M172), W171 (≠ F176), M307 (= M320), G309 (= G322), T311 (= T324)
- binding pyridoxal-5'-phosphate: G117 (= G122), S118 (= S123), Y150 (= Y155), H151 (= H156), G152 (= G157), E213 (= E222), D247 (= D256), I249 (= I258), K276 (= K285), P310 (= P323), T311 (= T324)
4xjlA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a hts lead compound
49% identity, 95% coverage: 13:432/442 of query aligns to 4:419/429 of 4xjlA
- active site: Y18 (= Y27), Y150 (= Y155), E213 (= E222), D247 (= D256), A250 (= A259), K276 (= K285), Y400 (= Y413)
- binding N-(1,2,3-benzothiadiazol-5-yl)-4-phenylpiperazine-1-carboxamide: P17 (= P26), Y18 (= Y27), W57 (= W62), M84 (= M89), G86 (= G91), Y150 (= Y155), C161 (= C166), G165 (≠ N170), G166 (= G171), A219 (= A228)
- binding pyridoxal-5'-phosphate: G117 (= G122), S118 (= S123), Y150 (= Y155), H151 (= H156), G152 (= G157), E213 (= E222), D247 (= D256), I249 (= I258), K276 (= K285), P310 (= P323), T311 (= T324)
4wygA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis complexed with a fragment hit (see paper)
49% identity, 95% coverage: 13:432/442 of query aligns to 4:419/429 of 4wygA
- active site: Y18 (= Y27), Y150 (= Y155), E213 (= E222), D247 (= D256), A250 (= A259), K276 (= K285), Y400 (= Y413)
- binding 1-{4-[(4-chloro-1H-pyrazol-1-yl)methyl]phenyl}methanamine: Y18 (= Y27), W57 (= W62), W58 (= W63), Y150 (= Y155), A219 (= A228), F395 (= F408)
- binding pyridoxal-5'-phosphate: G117 (= G122), S118 (= S123), Y150 (= Y155), H151 (= H156), E213 (= E222), D247 (= D256), I249 (= I258), K276 (= K285), P310 (= P323), T311 (= T324)
4wyeA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis complexed with a dsf fragment hit (see paper)
49% identity, 95% coverage: 13:432/442 of query aligns to 4:419/429 of 4wyeA
- active site: Y18 (= Y27), Y150 (= Y155), E213 (= E222), D247 (= D256), A250 (= A259), K276 (= K285), Y400 (= Y413)
- binding phenyl(piperidin-4-yl)methanone: Y18 (= Y27), W57 (= W62), W58 (= W63), A219 (= A228), F395 (= F408), Y400 (= Y413)
- binding pyridoxal-5'-phosphate: G117 (= G122), S118 (= S123), Y150 (= Y155), H151 (= H156), G152 (= G157), E213 (= E222), D247 (= D256), I249 (= I258), K276 (= K285), P310 (= P323), T311 (= T324)
4w1xA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with 1-(4-(4-(3-chlorobenzoyl) piperazin-1-yl)phenyl)ethanone (see paper)
49% identity, 95% coverage: 13:432/442 of query aligns to 4:419/429 of 4w1xA
- active site: Y18 (= Y27), Y150 (= Y155), E213 (= E222), D247 (= D256), A250 (= A259), K276 (= K285), Y400 (= Y413)
- binding 1-{4-[4-(3-chlorobenzoyl)piperazin-1-yl]phenyl}ethanone: P17 (= P26), Y18 (= Y27), W57 (= W62), M84 (= M89), G86 (= G91), Y150 (= Y155), G165 (≠ N170), G166 (= G171), A219 (= A228), G309 (= G322), T311 (= T324)
- binding pyridoxal-5'-phosphate: G117 (= G122), S118 (= S123), Y150 (= Y155), H151 (= H156), G152 (= G157), E213 (= E222), D247 (= D256), I249 (= I258), K276 (= K285), P310 (= P323), T311 (= T324)
4w1wA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with 7-(diethylamino)-3- (thiophene-2-carbonyl)-2h-chromen-2-one (see paper)
49% identity, 95% coverage: 13:432/442 of query aligns to 4:419/429 of 4w1wA
- active site: Y18 (= Y27), Y150 (= Y155), E213 (= E222), D247 (= D256), A250 (= A259), K276 (= K285), Y400 (= Y413)
- binding 7-(diethylamino)-3-(thiophen-2-ylcarbonyl)-2H-chromen-2-one: P17 (= P26), Y18 (= Y27), W57 (= W62), M84 (= M89), G86 (= G91), Y150 (= Y155), G165 (≠ N170), G309 (= G322), P310 (= P323), R393 (= R406)
- binding pyridoxal-5'-phosphate: G117 (= G122), S118 (= S123), Y150 (= Y155), H151 (= H156), G152 (= G157), E213 (= E222), D247 (= D256), I249 (= I258), K276 (= K285), P310 (= P323), T311 (= T324)
Query Sequence
>WP_024850313.1 NCBI__GCF_000526715.1:WP_024850313.1
MTPSKPNLSEHWKELLAFDQQHIWHPYAKMPADTPAIGVASTQGSVITLADGTELVDGMS
SWWAALHGYNHPKIQQAMHEQIDIMPHIMFGGLTHEPAIELSKRLVKLTPEGLDKVFLVD
SGSVAMEVAIKMALQYWVSKDQPNKNRLLTVRNGYHGDTFATMAVCDPVNGMHSLFSEIL
TQHYFAPEPEMGFDIESDNQDINSLKTMLEEHHNNIAAVTIEPIVQGAGGMRFYRPDYLK
QLRQLCDEYGVLLIADEIATGFGRTGKLFACEWAGITPDIMTLGKTLTGGHISLAATLAT
TDVSDTISSNVGDLNPGLLMHGPTFMGNPLACAAAIANIDVLMNSPWQDNIQRIEEHFTE
TLLPLKELEGVADARVLGAIGVIELERSDLGPQVQAKGIENGIWLRPFGRLVYTMPAYNI
SQSNLSKLTSMLTCTLGTVIAK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory