Comparing WP_024850430.1 NCBI__GCF_000526715.1:WP_024850430.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3r7lA Crystal structure of pala-bound aspartate transcarbamoylase from bacillus subtilis (see paper)
41% identity, 87% coverage: 16:313/341 of query aligns to 1:285/290 of 3r7lA
3r7fA Crystal structure of cp-bound aspartate transcarbamoylase from bacillus subtilis (see paper)
41% identity, 87% coverage: 16:313/341 of query aligns to 1:285/291 of 3r7fA
3r7dA Crystal structure of unliganded aspartate transcarbamoylase from bacillus subtilis (see paper)
41% identity, 87% coverage: 16:313/341 of query aligns to 1:285/291 of 3r7dA
P05654 Aspartate carbamoyltransferase catalytic subunit; Aspartate transcarbamylase; ATCase; EC 2.1.3.2 from Bacillus subtilis (strain 168) (see paper)
41% identity, 87% coverage: 16:313/341 of query aligns to 1:285/304 of P05654
Sites not aligning to the query:
4bjhB Crystal structure of the aquifex reactor complex formed by dihydroorotase (h180a, h232a) with dihydroorotate and aspartate transcarbamoylase with n-(phosphonacetyl)-l-aspartate (pala) (see paper)
40% identity, 89% coverage: 16:317/341 of query aligns to 1:290/291 of 4bjhB
3d6nB Crystal structure of aquifex dihydroorotase activated by aspartate transcarbamoylase (see paper)
40% identity, 89% coverage: 16:317/341 of query aligns to 1:290/291 of 3d6nB
6pnzA The structure of the aspartate transcarbamoylase trimer from staphylococcus aureus complexed with pala at 2.27 resolution.
35% identity, 89% coverage: 16:318/341 of query aligns to 1:293/293 of 6pnzA
P07259 Multifunctional protein URA2; Pyrimidine-specific carbamoyl phosphate synthase-aspartate carbamoyl transferase; CPSase-ATCase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
35% identity, 91% coverage: 8:316/341 of query aligns to 1902:2209/2214 of P07259
Sites not aligning to the query:
4eknB Structure of the catalytic chain of methanococcus jannaschii aspartate transcarbamoylase in a hexagonal crystal form (see paper)
35% identity, 87% coverage: 16:313/341 of query aligns to 1:296/304 of 4eknB
1ml4A The pala-liganded aspartate transcarbamoylase catalytic subunit from pyrococcus abyssi (see paper)
35% identity, 89% coverage: 15:317/341 of query aligns to 3:304/307 of 1ml4A
8bplA Aspartate transcarbamoylase mutant (n2045c, r2238c) from chaetomium thermophilum cad-like bound to carbamoyl phosphate (see paper)
35% identity, 78% coverage: 51:316/341 of query aligns to 49:314/316 of 8bplA
5g1nE Aspartate transcarbamoylase domain of human cad bound to pala (see paper)
32% identity, 88% coverage: 17:317/341 of query aligns to 6:304/307 of 5g1nE
P27708 Multifunctional protein CAD; Carbamoyl phosphate synthetase 2-aspartate transcarbamylase-dihydroorotase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Homo sapiens (Human) (see 7 papers)
32% identity, 88% coverage: 17:317/341 of query aligns to 1924:2222/2225 of P27708
Sites not aligning to the query:
P08955 Multifunctional protein CAD; Carbamoyl phosphate synthetase 2-aspartate transcarbamylase-dihydroorotase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Mesocricetus auratus (Golden hamster) (see paper)
32% identity, 88% coverage: 17:317/341 of query aligns to 1924:2222/2225 of P08955
Sites not aligning to the query:
5g1pA Aspartate transcarbamoylase domain of human cad bound to carbamoyl phosphate (see paper)
32% identity, 88% coverage: 17:317/341 of query aligns to 3:289/292 of 5g1pA
P20054 Multifunctional protein pyr1-3; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Dictyostelium discoideum (Social amoeba)
35% identity, 78% coverage: 52:317/341 of query aligns to 1957:2221/2225 of P20054
Sites not aligning to the query:
Q09794 Multifunctional protein ura1; Pyrimidine-specific carbamoyl phosphate synthase-aspartate carbamoyl transferase; CPSase-ATCase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
35% identity, 78% coverage: 51:316/341 of query aligns to 1970:2236/2244 of Q09794
Sites not aligning to the query:
2hseA Structure of d236a e. Coli aspartate transcarbamoylase in the presence of phosphonoacetamide and l-aspartate at 2.60 a resolution
33% identity, 88% coverage: 17:317/341 of query aligns to 7:304/310 of 2hseA
2a0fA Structure of d236a mutant e. Coli aspartate transcarbamoylase in presence of phosphonoacetamide at 2.90 a resolution (see paper)
33% identity, 88% coverage: 17:317/341 of query aligns to 7:304/310 of 2a0fA
P0A786 Aspartate carbamoyltransferase catalytic subunit; Aspartate transcarbamylase; ATCase; EC 2.1.3.2 from Escherichia coli (strain K12) (see 4 papers)
33% identity, 88% coverage: 17:317/341 of query aligns to 8:305/311 of P0A786
Sites not aligning to the query:
>WP_024850430.1 NCBI__GCF_000526715.1:WP_024850430.1
MRLSTPNIQLNEKGKLRHFLTIEGLKHHHLTEILDVAESFIDPSTGDINKLDTLHGKAIM
NLFFEPSTRTLTTFEIAEKRLSADVVNLNIETSSTKKGETLLDTLWNLEAMLADMFVVRH
SESGAAHFIAKHVAPHVHIVNAGDGQHAHPTQAMLDMFTIRKHKGDIFDLKVAIIGDVQH
SRVVRSQIQALSILEAREIRVIGPKTLMPSHPEALGIHVYDNVEEGLEGVDVVINVRLQN
ERMKSALLPSEKEFFNLYGLTKERLAFAKPDAIVMHPGPINRGVEIDSEVADGEQSVILE
QVTYGIAVRMAVMDIIFRNAKELLEEKRQALLDINTMETSE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory