Comparing WP_024851172.1 NCBI__GCF_000526715.1:WP_024851172.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
63% identity, 95% coverage: 16:375/377 of query aligns to 17:375/377 of 7t1qA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
59% identity, 99% coverage: 2:376/377 of query aligns to 3:376/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
59% identity, 99% coverage: 2:375/377 of query aligns to 3:375/375 of 4pqaA
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
56% identity, 99% coverage: 3:375/377 of query aligns to 8:379/380 of 5vo3A
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
56% identity, 99% coverage: 3:375/377 of query aligns to 4:375/377 of P44514
7lgpB Dape enzyme from shigella flexneri
56% identity, 99% coverage: 4:375/377 of query aligns to 7:376/377 of 7lgpB
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
59% identity, 47% coverage: 2:179/377 of query aligns to 3:180/265 of 4op4B
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
57% identity, 49% coverage: 3:185/377 of query aligns to 6:186/258 of 4h2kA
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
25% identity, 82% coverage: 57:364/377 of query aligns to 95:410/426 of 3pfoA
7uoiA Crystallographic structure of dape from enterococcus faecium
25% identity, 99% coverage: 3:375/377 of query aligns to 9:382/383 of 7uoiA
7rsfA Acetylornithine deacetylase from escherichia coli
24% identity, 97% coverage: 5:371/377 of query aligns to 6:374/380 of 7rsfA
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
24% identity, 98% coverage: 4:374/377 of query aligns to 12:398/408 of Q03154
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
23% identity, 98% coverage: 4:374/377 of query aligns to 12:397/407 of P37111
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
22% identity, 97% coverage: 3:367/377 of query aligns to 48:496/507 of Q96KN2
Sites not aligning to the query:
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
23% identity, 84% coverage: 59:373/377 of query aligns to 119:489/503 of Q8C165
3dljA Crystal structure of human carnosine dipeptidase 1
23% identity, 97% coverage: 3:367/377 of query aligns to 19:461/471 of 3dljA
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
30% identity, 21% coverage: 61:139/377 of query aligns to 86:164/458 of 2pokA
Sites not aligning to the query:
4mmoA The crystal structure of a m20 family metallo-carboxypeptidase sso-cp2 from sulfolobus solfataricus
28% identity, 20% coverage: 61:134/377 of query aligns to 66:138/437 of 4mmoA
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
22% identity, 94% coverage: 10:363/377 of query aligns to 14:359/373 of 3rzaA
1lfwA Crystal structure of pepv (see paper)
37% identity, 25% coverage: 9:101/377 of query aligns to 21:121/468 of 1lfwA
Sites not aligning to the query:
>WP_024851172.1 NCBI__GCF_000526715.1:WP_024851172.1
MSETIQLAQQLIRIDSVTPNDKGCQNLITDFLAPLGFKIEQMNFGEVSNLWARYGTKGPF
IVFAGHTDVVPTGPVERWTHPPFEAKIDNGMLVGRGSADMKSSIACFMIATQQFLSNHPN
TNGSIGFLITSDEEGPAIDGTVKVVETLEARNEKFDYCLVGEPSSSKKLGDSIKNGRRGS
LSGKLRIKGIQGHIAYPELARNPIHTFAPALLNLTEKVWDNGNEYFPPTSFQVSNIHSGT
GTTNVIPGDCIVDFNFRFSTEQTPEKLKDAVHGILDDNQLEYDLDWNLSGMPFITPADGK
LIQAVKKAVEAELGYEPQLSTGGGTSDGRFIATTGAQVIELGPLNDTIHKIDEQVSTADL
EKLTQIYYQTLVNLLVN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory