SitesBLAST
Comparing WP_024851689.1 NCBI__GCF_000526715.1:WP_024851689.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P19938 D-alanine aminotransferase; D-amino acid aminotransferase; D-amino acid transaminase; DAAT; D-aspartate aminotransferase; EC 2.6.1.21 from Bacillus sp. (strain YM-1) (see 5 papers)
41% identity, 91% coverage: 17:278/289 of query aligns to 15:274/283 of P19938
- Y32 (= Y34) binding
- R51 (= R53) binding
- R99 (≠ V101) binding
- H101 (≠ D103) binding
- K146 (= K149) active site, Proton acceptor; modified: N6-(pyridoxal phosphate)lysine
- E178 (= E182) binding ; mutation to K: Loss of transaminase activity and small gain in racemase activity.
- L202 (= L206) mutation to A: Inactivates enzyme.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3daaA Crystallographic structure of d-amino acid aminotransferase inactivated by pyridoxyl-d-alanine (see paper)
41% identity, 91% coverage: 17:278/289 of query aligns to 14:273/277 of 3daaA
- active site: Y31 (= Y34), V33 (= V36), K145 (= K149), E177 (= E182), L201 (= L206)
- binding n-(5'-phosphopyridoxyl)-d-alanine: Y31 (= Y34), R50 (= R53), K145 (= K149), E177 (= E182), S180 (≠ A185), S181 (= S186), L201 (= L206), G203 (= G208), I204 (= I209), T205 (= T210), S240 (= S245), T241 (≠ S246)
2daaA Crystallographic structure of d-amino acid aminotransferase inactivated by d-cycloserine
41% identity, 91% coverage: 17:278/289 of query aligns to 14:273/277 of 2daaA
- active site: Y31 (= Y34), V33 (= V36), K145 (= K149), E177 (= E182), L201 (= L206)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: Y31 (= Y34), V33 (= V36), R50 (= R53), R98 (≠ V101), H100 (≠ D103), K145 (= K149), E177 (= E182), S180 (≠ A185), S181 (= S186), N182 (= N187), L201 (= L206), G203 (= G208), I204 (= I209), T205 (= T210), T241 (≠ S246)
1daaA Crystallographic structure of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate (see paper)
41% identity, 91% coverage: 17:278/289 of query aligns to 14:273/277 of 1daaA
- active site: Y31 (= Y34), V33 (= V36), K145 (= K149), E177 (= E182), L201 (= L206)
- binding pyridoxal-5'-phosphate: R50 (= R53), K145 (= K149), E177 (= E182), S180 (≠ A185), S181 (= S186), L201 (= L206), G203 (= G208), I204 (= I209), T205 (= T210), S240 (= S245), T241 (≠ S246)
3lqsA Complex structure of d-amino acid aminotransferase and 4-amino-4,5- dihydro-thiophenecarboxylic acid (adta) (see paper)
41% identity, 91% coverage: 17:278/289 of query aligns to 14:273/280 of 3lqsA
- active site: Y31 (= Y34), V33 (= V36), K145 (= K149), E177 (= E182), L201 (= L206)
- binding 4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]thiophene-2-carboxylic acid: V33 (= V36), R50 (= R53), E177 (= E182), S180 (≠ A185), S181 (= S186), N182 (= N187), L201 (= L206), G203 (= G208), I204 (= I209), T205 (= T210), S240 (= S245), T241 (≠ S246), T242 (= T247)
1a0gB L201a mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate (see paper)
41% identity, 91% coverage: 17:278/289 of query aligns to 14:273/282 of 1a0gB
- active site: Y31 (= Y34), V33 (= V36), K145 (= K149), E177 (= E182), A201 (≠ L206)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R50 (= R53), K145 (= K149), E177 (= E182), S180 (≠ A185), S181 (= S186), G203 (= G208), I204 (= I209), T205 (= T210), S240 (= S245), T241 (≠ S246)
5mr0D Thermophilic archaeal branched-chain amino acid transaminases from geoglobus acetivorans and archaeoglobus fulgidus: biochemical and structural characterisation (see paper)
34% identity, 96% coverage: 7:283/289 of query aligns to 5:283/290 of 5mr0D
- active site: F32 (≠ Y34), G34 (≠ V36), K150 (= K149), E183 (= E182), L206 (= L206)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R51 (= R53), G100 (≠ V101), L101 (≠ R102), K150 (= K149), Y154 (≠ L153), E183 (= E182), G186 (≠ A185), D187 (≠ S186), L206 (= L206), I209 (= I209), T210 (= T210), G245 (≠ S245), T246 (≠ S246)
5e25A Crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate (see paper)
33% identity, 97% coverage: 2:282/289 of query aligns to 1:284/290 of 5e25A
- active site: F33 (≠ Y34), G35 (≠ V36), K151 (= K149), E184 (= E182), L207 (= L206)
- binding 2-oxoglutaric acid: Y88 (≠ F89), K151 (= K149), T247 (≠ S246), A248 (≠ T247)
- binding pyridoxal-5'-phosphate: R52 (= R53), K151 (= K149), Y155 (≠ L153), E184 (= E182), G187 (≠ A185), D188 (≠ S186), L207 (= L206), G209 (= G208), I210 (= I209), T211 (= T210), G246 (≠ S245), T247 (≠ S246)
7p3tB Transaminase of gamma-proteobacterium (see paper)
35% identity, 92% coverage: 3:269/289 of query aligns to 3:271/299 of 7p3tB
- binding pyridoxal-5'-phosphate: R53 (= R53), K153 (= K149), R157 (≠ L153), E186 (= E182), S187 (≠ G183), A188 (≠ T184), A189 (= A185), S190 (= S186), G210 (= G208), I211 (= I209), T212 (= T210), T248 (≠ S246)
6snlD (R)-selective amine transaminase from exophiala sideris (see paper)
31% identity, 94% coverage: 1:273/289 of query aligns to 24:300/320 of 6snlD
- active site: Y57 (= Y34), K178 (≠ T151), E211 (= E182), L233 (= L206)
- binding pyridoxal-5'-phosphate: R76 (= R53), K178 (≠ T151), E211 (= E182), G214 (≠ A185), F215 (≠ S186), L233 (= L206), G235 (= G208), V236 (≠ I209), T237 (= T210), T273 (≠ S246)
6fteB Crystal structure of an (r)-selective amine transaminase from exophiala xenobiotica
27% identity, 94% coverage: 1:273/289 of query aligns to 25:301/321 of 6fteB
- active site: Y58 (= Y34), K179 (≠ T151), E212 (= E182), L234 (= L206)
- binding pyridoxal-5'-phosphate: R77 (= R53), K179 (≠ T151), E212 (= E182), F216 (≠ S186), N217 (= N187), L234 (= L206), G236 (= G208), V237 (≠ I209), T238 (= T210), T274 (≠ S246)
6xwbA Crystal structure of an r-selective transaminase from thermomyces stellatus. (see paper)
28% identity, 96% coverage: 1:278/289 of query aligns to 25:306/319 of 6xwbA
- binding pyridoxal-5'-phosphate: R77 (= R53), K178 (≠ E139), F185 (≠ I148), E211 (= E182), G214 (≠ A185), F215 (≠ S186), N216 (= N187), L233 (= L206), G235 (= G208), V236 (≠ I209), T237 (= T210), T273 (≠ S246)
4cmfA The (r)-selective transaminase from nectria haematococca with inhibitor bound (see paper)
29% identity, 93% coverage: 1:269/289 of query aligns to 25:297/322 of 4cmfA
- active site: Y58 (= Y34), V60 (= V36), K179 (= K149), E212 (= E182), L234 (= L206)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: V60 (= V36), R77 (= R53), F113 (= F89), K179 (= K149), E212 (= E182), G215 (≠ A185), F216 (≠ S186), N217 (= N187), L234 (= L206), G236 (= G208), I237 (= I209), T238 (= T210), T273 (≠ S245), T274 (≠ S246), A275 (≠ T247)
4cmdA The (r)-selective transaminase from nectria haematococca (see paper)
29% identity, 93% coverage: 1:269/289 of query aligns to 25:297/322 of 4cmdA
- active site: Y58 (= Y34), V60 (= V36), K179 (= K149), E212 (= E182), L234 (= L206)
- binding pyridoxal-5'-phosphate: R77 (= R53), K179 (= K149), E212 (= E182), G215 (≠ A185), F216 (≠ S186), L234 (= L206), G236 (= G208), I237 (= I209), T238 (= T210), T274 (≠ S246)
6xu3C (R)-selective amine transaminase from shinella sp. (see paper)
28% identity, 94% coverage: 1:273/289 of query aligns to 25:300/322 of 6xu3C
- active site: Y58 (= Y34), K178 (vs. gap), E211 (= E182), L233 (= L206)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: V60 (= V36), R77 (= R53), K178 (vs. gap), F185 (vs. gap), E211 (= E182), G214 (≠ A185), N216 (= N187), L233 (= L206), G235 (= G208), V236 (≠ I209), T237 (= T210), T272 (≠ S245), T273 (≠ S246), A274 (≠ T247)
6xu3B (R)-selective amine transaminase from shinella sp. (see paper)
28% identity, 94% coverage: 1:273/289 of query aligns to 24:299/321 of 6xu3B
- active site: Y57 (= Y34), K177 (vs. gap), E210 (= E182), L232 (= L206)
- binding 3-aminobenzoic acid: P169 (≠ A150), D173 (≠ L154), K229 (≠ N203)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: R76 (= R53), Y112 (≠ F89), K177 (vs. gap), F184 (vs. gap), E210 (= E182), G213 (≠ A185), F214 (≠ S186), N215 (= N187), L232 (= L206), G234 (= G208), V235 (≠ I209), T236 (= T210), T272 (≠ S246)
6xu3A (R)-selective amine transaminase from shinella sp. (see paper)
28% identity, 94% coverage: 1:273/289 of query aligns to 23:298/320 of 6xu3A
- active site: Y56 (= Y34), K176 (vs. gap), E209 (= E182), L231 (= L206)
- binding pyridoxal-5'-phosphate: R75 (= R53), K176 (vs. gap), F183 (vs. gap), E209 (= E182), G212 (≠ A185), F213 (≠ S186), L231 (= L206), G233 (= G208), V234 (≠ I209), T235 (= T210), T271 (≠ S246)
4ce5B First crystal structure of an (r)-selective omega-transaminase from aspergillus terreus (see paper)
28% identity, 94% coverage: 1:273/289 of query aligns to 27:302/325 of 4ce5B
- active site: Y60 (= Y34), K180 (≠ T151), E213 (= E182), L235 (= L206)
- binding calcium ion: D67 (≠ Q41), R69 (≠ K43)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-d-glutamic acid: V62 (= V36), R79 (= R53), K180 (≠ T151), W184 (≠ P155), E213 (= E182), G216 (≠ A185), F217 (≠ S186), N218 (= N187), L235 (= L206), G237 (= G208), V238 (≠ I209), T239 (= T210), T274 (≠ S245), T275 (≠ S246), A276 (≠ T247)
- binding pyridoxal-5'-phosphate: R79 (= R53), K180 (≠ T151), E213 (= E182), G216 (≠ A185), F217 (≠ S186), L235 (= L206), G237 (= G208), V238 (≠ I209), T239 (= T210), T275 (≠ S246)
4ce5A First crystal structure of an (r)-selective omega-transaminase from aspergillus terreus (see paper)
28% identity, 94% coverage: 1:273/289 of query aligns to 27:302/325 of 4ce5A
- active site: Y60 (= Y34), K180 (≠ T151), E213 (= E182), L235 (= L206)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-d-glutamic acid: Y60 (= Y34), V62 (= V36), R79 (= R53), K180 (≠ T151), W184 (≠ P155), E213 (= E182), G216 (≠ A185), F217 (≠ S186), N218 (= N187), L235 (= L206), G237 (= G208), V238 (≠ I209), T239 (= T210), T274 (≠ S245), T275 (≠ S246)
- binding pyridoxal-5'-phosphate: R79 (= R53), K180 (≠ T151), E213 (= E182), F217 (≠ S186), L235 (= L206), G237 (= G208), V238 (≠ I209), T239 (= T210), T275 (≠ S246)
8ivpB Crystal structure of mv in complex with llp and fru from mycobacterium vanbaalenii
30% identity, 92% coverage: 5:269/289 of query aligns to 30:298/322 of 8ivpB
Query Sequence
>WP_024851689.1 NCBI__GCF_000526715.1:WP_024851689.1
MSEQIAYLNGDFLPLTEAKVSAQDRGFLFGDGIYEVIPVFQKKLFQLNAHLDRLRNSLNA
VSIQDPYTDTQWETLLNDLIQKHPWDNQFVYLHVTRGVQLVRDHLPENNLKPTVYAYTNP
LKPVADHILKHGIKAVTLEDIRWLRCDIKATTLLPNVMMKLAAKQQGADDAILIGRDQTI
SEGTASNVFIVKDGVLHTPPLSNRILPGITRMMIEKIALDHNIPLLEQQLFLADLETADE
IWLTSSTKDALPVCSLNNNTIGSGKPGPIWRKMQAYFEQTKQALMAAED
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory