SitesBLAST
Comparing WP_025164931.1 NCBI__GCF_000498575.2:WP_025164931.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534) (see paper)
27% identity, 48% coverage: 23:233/440 of query aligns to 56:250/444 of Q8NLB7
- D57 (= D24) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (≠ K77) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 54 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
8et8A Cryo-em structure of the organic cation transporter 1 in complex with verapamil (see paper)
28% identity, 37% coverage: 59:222/440 of query aligns to 156:297/532 of 8et8A
Sites not aligning to the query:
- binding (2S)-2-(3,4-dimethoxyphenyl)-5-{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino}-2-(propan-2-yl)pentanenitrile: 31, 35, 353, 360, 378, 381, 385, 449, 469
8et7A Cryo-em structure of the organic cation transporter 1 in complex with diphenhydramine (see paper)
28% identity, 37% coverage: 59:222/440 of query aligns to 156:297/532 of 8et7A
Sites not aligning to the query:
8jttA Hoct1 in complex with metformin in outward occluded conformation (see paper)
28% identity, 35% coverage: 67:222/440 of query aligns to 84:220/454 of 8jttA
Sites not aligning to the query:
O15245 Solute carrier family 22 member 1; Organic cation transporter 1; hOCT1 from Homo sapiens (Human) (see 10 papers)
28% identity, 35% coverage: 67:222/440 of query aligns to 162:298/554 of O15245
- S189 (≠ A94) to L: no changes in MPP(+) uptake; dbSNP:rs34104736
- G220 (≠ A133) to V: affects transporter activity; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs36103319
- Y240 (≠ P153) mutation to F: Decreased TEA uptake.
- P283 (≠ M207) to L: in dbSNP:rs4646277; mutation to A: Decreased TEA uptake.
- R287 (≠ E211) to G: in dbSNP:rs4646278
Sites not aligning to the query:
- 14 S → F: exclusively found in the African American population; increased MPP(+) uptake when associated with V-408; dbSNP:rs34447885
- 24 I→L: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 28 L→I: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 31 A→S: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 32 F→L: No change in fenoterol uptake. Decreased trospium uptake. Decreased trospium affinity.
- 36 C→Y: Increased fenoterol uptake. Increased fenoterol affinity. No change in trospium uptake. No change in terbutaline uptake. No change in terbutaline affinity.
- 41 F → L: in dbSNP:rs2297373
- 61 R → C: affects transporter activity; reduction of MPP(+) uptake; reduction of serum O-isobutanoyl-(R)-carnitine levels; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs12208357
- 85 L → F: no changes in MPP(+) uptake; when associated with V-408; dbSNP:rs35546288
- 88 C → R: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; dbSNP:rs55918055
- 160 L → F: no changes in both MPP(+) and TEA uptake; abolishes MPP(+) uptake when associated with S-401; largely localized to the plasma membrane; dbSNP:rs683369
- 341 P → L: affects transporter activity; reduction of TEA uptake; reduction o MPP(+) uptake when associated with V-408; largely localized to the plasma membrane; dbSNP:rs2282143
- 342 R → H: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34205214
- 361 Y→F: Decreased TEA uptake.
- 376 Y→F: Decreased TEA uptake.
- 401 G → S: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; no MPP(+) uptake when associated with L-160; dbSNP:rs34130495
- 408 M → V: does not affect transporter activity; no changes in MPP(+) uptake when associated with F-14; no changes in MPP(+) uptake when associated with F-85; no changes in MPP(+) uptake when associated with L-189; no changes in MPP(+) uptake when associated with H-342; no changes in MPP(+) uptake when associated with M-420 del; no changes in MPP(+) uptake when associated with I-440; no changes in MPP(+) uptake when associated with I-461; no changes in MPP(+) uptake when associated with M-488; reduction of MPP uptake when associated with C-61; no MPP(+) uptake when associated with V-220; reduction of MPP(+) uptake when associated with L-341; no MPP(+) uptake when associated with S-401; no MPP(+) uptake when associated with R-465; dbSNP:rs628031
- 420 natural variant: Missing (reduction of serum O-isobutanoyl-(R)-carnitine levels; no change in MPP(+) uptake; no changes in MPP(+) uptake when associated with V-408; dbSNP:rs72552763)
- 440 M → I: in dbSNP:rs35956182
- 461 V → I: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34295611
- 465 G → R: reduction of the localization to the basolateral membrane; no MPP(+) uptake when associated with V-408; dbSNP:rs34059508; G→A: No changes in MPP(+) uptake.
- 488 R → M: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs35270274
8jtzA Hoct1 in complex with spironolactone in outward facing partially occluded conformation (see paper)
28% identity, 35% coverage: 67:222/440 of query aligns to 160:296/530 of 8jtzA
Sites not aligning to the query:
8fvzA Pipt y150a
29% identity, 32% coverage: 6:147/440 of query aligns to 1:138/433 of 8fvzA
Sites not aligning to the query:
O08966 Solute carrier family 22 member 1; Organic cation transporter 1; mOCT1 from Mus musculus (Mouse) (see paper)
26% identity, 36% coverage: 66:222/440 of query aligns to 162:299/556 of O08966
Sites not aligning to the query:
- 32 L→F: Increased trospium uptake. Increased trospium affinity. No change in fenoterol uptake.
- 36 Y→C: Decreased fenoterol uptake. Decreased fenoterol affinity. No change in trospium uptake. No change in terbutaline affinity.
Q63089 Solute carrier family 22 member 1; Organic cation transporter 1; rOCT1 from Rattus norvegicus (Rat) (see 4 papers)
27% identity, 36% coverage: 66:222/440 of query aligns to 162:299/556 of Q63089
- C179 (≠ M83) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; S-322; A-358; A-418; S-437; A-470 and A-474.
- M212 (≠ I124) mutation to L: No change in TEA and MPP(+) uptake.
- V213 (≠ G125) mutation to G: Decreased TEA uptake. No change in MPP(+) uptake.
- S214 (≠ L126) mutation to G: Decreased TEA and MPP(+) uptake.
- K215 (≠ G127) mutation to Q: Loss of TEA and MPP(+) uptake activity.; mutation to R: Loss of TEA and MPP(+) uptake activity.
- G216 (= G128) mutation to A: Decreased TEA and MPP(+) uptake.
- S217 (≠ E129) mutation to G: No change in TEA and MPP(+) uptake.
- W218 (= W130) mutation to F: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. No change in TEA and MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, histamine, serotonin, TEA and MPP(+) uptake. Decreased TEA affinity. No change in MPP(+) affinity. Decreased TEA and MPP(+) Vmax.; mutation to Y: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
- V219 (≠ G131) mutation to L: No change in TEA and MPP(+) uptake.
- S220 (≠ G132) mutation to I: Decreased TEA and MPP(+) uptake.
- G221 (≠ A133) mutation to A: Decreased TEA and MPP(+) uptake.
- Y222 (≠ V134) mutation to F: No change in guanidine, histamine, serotonin, TEA and MPP(+) uptake. Increased TEA affinity. No change in MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, serotonin, TEA and MPP(+) uptake. No change in histamine uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
- T223 (≠ L135) mutation to I: Decreased TEA uptake. No change in MPP(+) uptake.
- L224 (≠ M136) mutation to V: Decreased TEA and MPP(+) uptake.
- I225 (≠ A137) mutation to G: No change in TEA and MPP(+) uptake.
- T226 (≠ F138) mutation to A: Decreased TEA uptake. No change in MPP(+) uptake.
- E227 (= E139) mutation to D: Loss of TEA and MPP(+) uptake activity.; mutation to Q: Loss of TEA and MPP(+) uptake activity.
- F228 (≠ Y140) mutation to I: No change in TEA and MPP(+) uptake.
- V229 (≠ A141) mutation to A: Decreased TEA and MPP(+) uptake.; mutation to L: Loss of TEA and MPP(+) uptake activity.
- S286 (= S209) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-292; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-292; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-292; A-296; A-328 and A-550.
- S292 (≠ V215) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-296; A-328 and A-550.
- T296 (≠ N219) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-328; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-328 and A-550.
Sites not aligning to the query:
- 26 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-155; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
- 155 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
- 322 C→S: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with M-451. Choline affinity is increased fivefold by MMTS. Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; A-358; A-418; S-437; A-470 and A-474. Choline affinity is increased four- to fivefold; when associated with M-451.
- 328 S→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-550.
- 358 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-418; S-437; A-470 and A-474.
- 418 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; S-437; A-470 and A-474.
- 437 C→S: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-470 and A-474.
- 451 C→M: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with S-322. Abolishes the effect of MMTs on choline-induced currents. Choline affinity is not influenced by MMTS. Choline affinity is increased four- to fivefold; when associated with S-322.
- 470 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-474.
- 474 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-470.
- 475 D→E: Decreased MPP(+) uptake, no change in MPP(+) affinity. Decreased NMN uptake, increased NMN affinity. Decreased choline uptake, increased choline affinity.; D→N: Decreased MPP(+) uptake.; D→R: Decreased MPP(+) uptake.
- 550 T→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296; A-328. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-328. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-328. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-328. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-328.
8sc2A Human oct1 bound to diltiazem in inward-open conformation (see paper)
26% identity, 39% coverage: 67:238/440 of query aligns to 144:299/453 of 8sc2A
Sites not aligning to the query:
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 6 papers)
29% identity, 49% coverage: 7:223/440 of query aligns to 63:287/587 of P25297
- C145 (≠ A94) mutation to S: No significant effect on transport activity; when associated with S-237, S-241, S-245, S-263, S-335, S-399, S-434, S-455, S-474, S-510 and S-519.
- F160 (≠ I109) mutation to C: Reduces phosphate binding, transport and signaling activities.
- R168 (= R119) mutation to A: Reduces transport activity. No significant effects on affinity for inorganic phosphate. No significant effects on growth rates.; mutation to C: Abolishes transport and signaling activities.; mutation to E: Reduces transport activity. Moderately reduces affinity for inorganic phosphate. No significant effects on growth rates.; mutation to Q: Reduces transport activity. Moderately reduces affinity for inorganic phosphate. Moderately reduces growth rates under low phosphate conditions. No significant effects on growth rates under high phosphate conditions.
- G172 (= G123) mutation to C: Abolishes transport and signaling activities.
- G174 (= G125) mutation to C: Abolishes transport and signaling activities.
- G176 (= G127) mutation to C: Abolishes transport and signaling activities.
- D178 (≠ E129) mutation D->E,N: Reduces transport activity. No significant effects on affinity for inorganic phosphate. No significant effects on signaling activities. No significant effects on growth rates.
- Y179 (≠ W130) mutation to A: Significantly reduces transport activity. Causes pronounced increase in secreted phosphatase activity under high phosphate conditions. Reduces growth rates under low phosphate conditions. Slightly reduces signaling activity.; mutation to G: Abolishes transport activity. Causes pronounced increase in secreted phosphatase activity under high phosphate conditions. Reduces growth rates under low phosphate conditions. Abolishes signaling activity.; mutation Y->S,F: No significant effects on transport activity. No significant effects on growth rates under low phosphate conditions. Does not affect patterns of secreted phosphatase activities under low and high phosphate conditions. No significant effects on signaling activity.
- C237 (≠ F180) mutation to S: No significant effect on transport activity; when associated with S-145, S-241, S-245, S-263, S-335, S-399, S-434, S-455, S-474, S-510 and S-519.
- C241 (vs. gap) mutation to S: No significant effect on transport activity; when associated with S-145, S-237, S-245, S-263, S-335, S-399, S-434, S-455, S-474, S-510 and S-519.
- C245 (≠ L181) mutation to S: No significant effect on transport activity; when associated with S-145, S-237, S-241, S-263, S-335, S-399, S-434, S-455, S-474, S-510 and S-519.
- C263 (≠ G199) mutation to S: No significant effect on transport activity; when associated with S-145, S-237, S-241, S-245, S-335, S-399, S-434, S-455, S-474, S-510 and S-519.
Sites not aligning to the query:
- 6 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
- 298 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); K→A: No significant effect on membrane localization under low phosphate conditions and internalization after phosphate addition. Strongly affects vacuolar sorting of the protein after internalization.
- 304:327 mutation Missing: Increases transport activity. Has no significant effect on membrane localization under low phosphate conditions. Results in severely delayed internalization after phosphate addition.
- 335 C→S: No significant effect on transport activity; when associated with S-145, S-237, S-241, S-245, S-263, S-399, S-434, S-455, S-474, S-510 and S-519.
- 358 D→E: Abolishes transport activity. Causes pronounced increase in secreted phosphatase activity under high phosphate conditions. Moderately decreases signaling activities. Significantly reduces growth rates under low phosphate conditions. No significant effects on growth rates under high phosphate conditions.; D→N: Significantly reduces transport activity. No significant effects on affinity for inorganic phosphate. Causes pronounced increase in secreted phosphatase activity under high phosphate conditions. No significant effects on signaling activities. Significantly reduces growth rates under low phosphate conditions. No significant effects on growth rates under high phosphate conditions.
- 392 V→C: Reduces transport and signaling activities.
- 399 C→S: No significant effect on transport activity; when associated with S-145, S-237, S-241, S-245, S-263, S-335, S-434, S-455, S-474, S-510 and S-519.
- 408 V→C: Reduces signaling activity and enhances transport activity.
- 434 C→S: No significant effect on transport activity; when associated with S-145, S-237, S-241, S-245, S-263, S-335, S-399, S-455, S-474, S-510 and S-519.
- 455 C→S: No significant effect on transport activity; when associated with S-145, S-237, S-241, S-245, S-263, S-335, S-399, S-434, S-474, S-510 and S-519.
- 473 E→K: No significant effects on transport activity. No significant effects on affinity for inorganic phosphate. No significant effects on growth rates.; E→Q: No significant effects on transport activity. Reduces affinity for inorganic phosphate. No significant effects on growth rates.
- 474 C→S: No significant effect on transport activity; when associated with S-145, S-237, S-241, S-245, S-263, S-335, S-399, S-434, S-455, S-510 and S-519.
- 492 mutation K->A,Q: No significant effects on transport activity. Reduces affinity for inorganic phosphate. No significant effects on growth rates.; K→E: Reduces transport activity. Reduces affinity for inorganic phosphate. Significantly reduces growth rates under low phosphate conditions. No significant effects on growth rates under high phosphate conditions.
- 510 C→S: No significant effect on transport activity; when associated with S-145, S-237, S-241, S-245, S-263, S-335, S-399, S-434, S-455, S-474 and S-519.
- 519 C→S: No significant effect on transport activity; when associated with S-145, S-237, S-241, S-245, S-263, S-335, S-399, S-434, S-455, S-474 and S-510.
8et9A Cryo-em structure of the organic cation transporter 2 in complex with 1-methyl-4-phenylpyridinium (see paper)
24% identity, 42% coverage: 52:237/440 of query aligns to 149:312/517 of 8et9A
Sites not aligning to the query:
O15244 Solute carrier family 22 member 2; Organic cation transporter 2; hOCT2 from Homo sapiens (Human) (see 8 papers)
25% identity, 42% coverage: 59:241/440 of query aligns to 158:318/555 of O15244
- M165 (≠ V69) to I: lower Vmax for MPP(+) transport; no change in transport efficiency (Vmax/Km) and clearance of cyclo(his-pro) and salsolinol; dbSNP:rs8177507
- Y169 (≠ H73) mutation to F: No change in TEA uptake.
- T201 (≠ I109) to M: in dbSNP:rs145450955
- Y241 (≠ P153) mutation to F: Slight decrease in TEA uptake. No change in tyrosine phosphorylation. Strong decrease in TEA uptake; when associated with F-362. Strong decrease in TEA and metformin uptake and YES1-mediated tyrosine phosphorylation; when associated with F-362 and F-377.
- Y257 (≠ A169) mutation to F: No change in TEA uptake.
- S270 (= S192) to A: decreased Ki value for TBA inhibition of MPP(+); no change in transport efficiency (Vmax/Km) and clearance of cyclo(his-pro) and salsolinol; dbSNP:rs316019
- Y279 (≠ G199) mutation to F: No change in TEA uptake.
- Y280 (≠ T200) mutation to F: No change in TEA uptake.
- P284 (≠ M207) mutation to A: Decreased TEA and metformin uptake. Decreased tyrosine phosphorylation.
- PESPR 284:288 (≠ MESPE 207:211) Proline-rich sequence
- S286 (= S209) mutation to A: No change in TEA and metformin uptake. No change in tyrosine phosphorylation.
- P287 (= P210) mutation to A: Decreased TEA and metformin uptake. Decreased tyrosine phosphorylation.
Sites not aligning to the query:
- 54 P → S: in dbSNP:rs8177504
- 73 Y→F: No change in TEA uptake.
- 92 Y→F: No change in TEA uptake.
- 128 Y→F: No change in TEA uptake.
- 362 Y→F: Decreased TEA uptake and YES1-mediated tyrosine phosphorylation. Strong decrease in TEA uptake; when associated with F-241. Strong decrease in TEA uptake; when associated with F-377. Strong decrease in TEA and metformin uptake and YES1-mediated tyrosine phosphorylation; when associated with F-241 and F-377.
- 377 Y→F: Slight decrease in TEA uptake. No change in tyrosine phosphorylation. Strong decrease in TEA uptake; when associated with F-362. Strong decrease in TEA and metformin uptake and YES1-mediated tyrosine phosphorylation; when associated with F-241 and F-362.
- 400 R → C: lower Vmax and reduced Ki value for TBA inhibition of MPP(+); lower transport efficiency (Vmax/Km) and clearance of cyclo(his-pro); no change in transport efficiency (Vmax/Km) and clearance of salsolinol; dbSNP:rs8177516
- 432 K → Q: lower Km value for MPP(+) and reduced Ki value for TBA inhibition of MPP; no change in transport efficiency (Vmax/Km) and clearance of cyclo(his-pro) and salsolinol; dbSNP:rs8177517
- 458 Y→F: No change in TEA uptake.
- 544 Y→F: No change in TEA uptake.
8sc6A Human oct1 bound to thiamine in inward-open conformation (see paper)
26% identity, 39% coverage: 67:238/440 of query aligns to 144:292/447 of 8sc6A
Sites not aligning to the query:
8sc3A Human oct1 bound to fenoterol in inward-open conformation (see paper)
28% identity, 26% coverage: 67:182/440 of query aligns to 144:247/445 of 8sc3A
Sites not aligning to the query:
Q8MJI6 Solute carrier family 22 member 2; Organic cation transporter 2 from Oryctolagus cuniculus (Rabbit) (see paper)
25% identity, 39% coverage: 66:237/440 of query aligns to 161:313/554 of Q8MJI6
Sites not aligning to the query:
- 71 N→Q: Higher affinity for TEA. Loss of plasma membrane localization; when associated with Q-76. Loss of plasma membrane localization; when associated with Q-112. Loss of plasma membrane localization; when associated with Q-76 and Q-112.
- 96 N→Q: Higher affinity for TEA and lower Vmax.
- 112 N→Q: Higher affinity for TEA, lower Vmax and loss of plasma membrane localization.
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
29% identity, 35% coverage: 64:219/440 of query aligns to 188:329/616 of P36035
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 9 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
- 338 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Query Sequence
>WP_025164931.1 NCBI__GCF_000498575.2:WP_025164931.1
MSTPNPVRKVVIASVIGATIEWYDFFLYGVVAGIVFNQLYFPSDDPLVSTMLAYGTFAVG
FLSRPIGGVIFGHFGDKIGRKSMLVMTMMIMGVATFLIGLVPSYDSIGIWAPILLLLLRI
FQGIGLGGEWGGAVLMAFEYAPKHQRGFYASLPQIGLAIGLCLASGVVAILSYSLTDTQF
LEWGWRIAFLLSAGLVFVGTWIRLNVMESPEFAKVKEANAEAAIPFVDMMKRYPKNVLAG
MGARYIDGVFFNVFGVFSLSYLTQTLNLPRSEALIGVMAAAVVMCFTIPMFGALSDRIGR
SRVYFWGSLITALSAFPAFWLMMTSNGDMFMIWMAIVIPFGIFYAAVYGPEAALFCELFD
AKVRYTGISFVYQFSGIFASGLTPIIATALMRSSDGQPWSTCFYVLFAGAVSAYCAWWIG
KRKGEQMTNEVNVGANAATS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory